IRF5 Antibody

Contact us
Catalog number: R32219
Price: Ask price €
Supplier: accurate-monoclonals
Product name: IRF5 Antibody
Quantity: 0.1 mg
Other quantities: 0.08 ml 199€ 0.1mg 389€ 0.4 ml 406€ 1 tube 411€ 1 vial 631€ 100ul 459€ bulk 0€
Related search:

More details :

Category: Antibody
Concentration: 2ml sterile DI water, 5mg/ml if reconstituted with 0
Form: Antigen affinity purified
Conjugation: Unconjugated
Clone: Polyclonal antibody
Recognised antigen: IRF5
Host animal: Rabbit (Oryctolagus cuniculus)
Clonality: Polyclonal (rabbit origin)
Species reactivity: Due to limited knowledge and inability to test the antibody against all known species, Mouse (Mus musculus), Rat , we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens)
Tested applications: IHC-P, WB
Recommended dilutions: 1-0, 5-1ug/ml, 5ug/ml, IHC (Paraffin): 0, Western blot: 0
Notes: Optimal dilution of the IRF5 antibody should be determined by the researcher
Intented use: This IRF5 antibodyis to be used only for research purposes and not for diagnostics
Uniprot #: Q13568
Purity: Antigen affinity
Description: This gene encodes a member of the interferon regulatory factor (IRF) family, a group of transcription factors with diverse roles, also called IRF5 or SLEB10, and immune system activity, and modulation of cell growth, apoptosis, differentiation, including virus-mediated activation of interferon, is a protein that in humans is encoded by the IRF5 gene, Interferon regulatory factor 5
Immunogen: Amino acids RLQISNPDLKDRMVEQFKELHHIWQSQQRLQ of human IRF5 were used as the immunogen for the IRF5 antibody
Storage: Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the IRF5 antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term
Localization: cytoplasmic, Nuclear
Properties: C, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24°
Gene target: IRF5
Short name: IRF5 Antibody
Technique: antibodies against human proteins, antibodies for, Antibody
Alternative name: interferon regulatory factor 5 (Antibody to)
Alternative technique: antibodies
Alternative to gene target: DNA-templated and biological process this GO :0006355 and regulation of transcription, DNA-templated and biological process this GO :0019221 and cytokine-mediated signaling pathway and biological process this GO :0032494 and response to peptidoglycan and biological process this GO :0032495 and response to muramyl dipeptide and biological process this GO :0032727 and positive regulation of interferon-alpha production and biological process this GO :0032728 and positive regulation of interferon-beta production and biological process this GO :0032735 and positive regulation of interleukin-12 production and biological process this GO :0043065 and positive regulation of apoptotic process and biological process this GO :0045087 and innate immune response and biological process this GO :0045944 and positive regulation of transcription from RNA polymerase II promoter and biological process this GO :0051607 and defense response to virus and biological process this GO :0060333 and interferon-gamma-mediated signaling pathway and biological process this GO :0060337 and type I interferon signaling pathway and biological process, IRF5 and IDBG-40393 and ENSG00000128604 and 3663, IRF5 and IDBG-635292 and ENSBTAG00000004989 and 615340, Irf5 and IDBG-132026 and ENSMUSG00000029771 and 27056, SLEB10, nuclei, protein binding, this GO :0000975 and regulatory region DNA binding and molecular function this GO :0003700 and sequence-specific DNA binding transcription factor activity and molecular function this GO :0005515 and protein binding and molecular function this GO :0005634 and nucleus and cellular component this GO :0005737 and cytoplasm and cellular component this GO :0005829 and cytosol and cellular component this GO :0006351 and transcription, this GO :0000975 : regulatory region DNA binding, this GO :0000975 : regulatory region DNA binding and also this GO :0003700 : sequence-specific DNA binding transcription factor activity and also this GO :0005515 : protein binding, this GO :0003700 : sequence-specific DNA binding transcription factor activity, this GO :0005515 : protein binding, interferon regulatory factor 5
Identity: 6120
Gene: IRF5 | More about : IRF5
Long gene name: interferon regulatory factor 5
Locus: 7q32, 1
Discovery year: 1996-05-31
Entrez gene record: 3663
RefSeq identity: NM_001098627
Havana BLAST/BLAT: OTTHUMG00000158410

Related Products :

SM6008 anti-IRF5 (176-240) Antibody 0,1 ml 500 € acr human
SM6008S anti-IRF5 (176-240) Antibody 50 Вµl 384 € acr human
AR51437PU-N anti-IRF5 (176-240, His-tag) Antibody 0,1 mg 1109 € acr human
AR51437PU-S anti-IRF5 (176-240, His-tag) Antibody 20 Вµg 485 € acr human
AM33091PU-N anti-IRF5 Antibody 0,1 mg 659 € acr human
AM33091PU-S anti-IRF5 Antibody 25 Вµg 427 € acr human
GENTAUR-58be01ef25dbb Anti- IRF5 Antibody 0.06 ml 265 € MBS Polyclonals human
GENTAUR-58be01ef909d4 Anti- IRF5 Antibody 0.12 ml 348 € MBS Polyclonals human
GENTAUR-58be13c99b5ba Anti- IRF5 Antibody 0.12 ml 348 € MBS Polyclonals human
GENTAUR-58be13c9f3e3e Anti- IRF5 Antibody 0.06 ml 265 € MBS Polyclonals human
GENTAUR-58be4460ec6ef Anti- IRF5 Antibody 100ug 393 € MBS Polyclonals human
abx216308 Anti-IRF5 Antibody 200 μg 369 € abbex human
abx216307 Anti-IRF5 (pS437) Antibody inquire 50 € abbex human
MBS421517 Goat anti-IRF5 Antibody 100ug 370 € MBS Polyclonals_1 human
F48241-0.08ML IRF5 Antibody 0.08 ml 199 € NJS poly human
F48241-0.4ML IRF5 Antibody 0.4 ml 406 € NJS poly human
GENTAUR-58be368e1861c IRF5 antibody 100ul 459 € MBS mono human
GWB-70DBA6 IRF5 antibody 1 tube 411 € genways human
GWB-B0C98A IRF5 antibody 1 vial 631 € genways human
GWB-BSP779 IRF5 Antibody bulk Ask price € genways bulk human
GWB-E8CA50 IRF5 antibody 1 vial 486 € genways human
GWB-ML229D IRF5 antibody 1 vial 521 € genways human
R31332 IRF5 Antibody 0.1mg 389 € NJS poly human
R32219 IRF5 Antibody 0.1mg 406 € NJS poly human
R35281-100UG IRF5 Antibody 0.1mg 406 € NJS poly human
BIN-003663-M01 IRF5 Antibody (M01), clone 2E3-1A11 0.1mg 495 € Zyagen human
BIN-003663-M05 IRF5 Antibody (M05), clone 2D4 0.1mg 495 € Zyagen human
YSRTMCA2701 IRF5, Mouse Monoclonal antibody-; Clone: 10T1, ELISA,WB,IP 0.1 mg 489 € accurate-monoclonals mouse
YSRTMCA4931Z IRF5, Mouse Monoclonal antibody-; Clone: 1H6 0.1 mg Ask price € accurate-monoclonals mouse
YSRTMCA4932Z IRF5, Mouse Monoclonal antibody-; Clone: 2D4 0.1 mg Ask price € accurate-monoclonals mouse