IKAROS Antibody / IKZF1

Contact us
Catalog number: R32214
Price: 322 €
Supplier: ABM lentivectors
Product name: IKAROS Antibody / IKZF1
Quantity: 1.0 µg DNA
Related search:

More details :

Category: Antibody
Concentration: 2ml sterile DI water, 5mg/ml if reconstituted with 0
Form: Antigen affinity purified
Conjugation: Unconjugated
Clone: Polyclonal antibody
Recognised antigen: IKAROS / IKZF1
Host animal: Rabbit (Oryctolagus cuniculus)
Clonality: Polyclonal (rabbit origin)
Species reactivity: Due to limited knowledge and inability to test the antibody against all known species, Mouse (Mus musculus), Rat , we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens)
Tested applications: IHC-P, WB
Recommended dilutions: 1-0, 5-1ug/ml, 5ug/ml, IHC (Paraffin): 0, Western blot: 0
Notes: Optimal dilution of the IKAROS antibody should be determined by the researcher
Intented use: This IKAROS antibodyis to be used only for research purposes and not for diagnostics
Uniprot #: Q13422
Purity: Antigen affinity
Description: Most isoforms share a common C-terminal domain, Only a few isoforms contain the requisite three or more N-terminal zinc motifs that confer high affinity binding to a specific core DNA sequence element in the promoters of target genes, Several alternatively spliced transcript variants encoding different isoforms have been described for this gene, The expression of this protein is restricted to the fetal and adult hemo-lymphopoietic system, The isoforms, The non-DNA-binding isoforms are largely found in the cytoplasm, This gene encodes a transcription factor that belongs to the family of zinc-finger DNA-binding proteins associated with chromatin remodeling, and are thought to function as dominant-negative factors, and for interactions with other proteins, and it functions as a regulator of lymphocyte differentiation, differ in the number of N-terminal zinc finger motifs that bind DNA and in nuclear localization signal presence, however, resulting in members with and without DNA-binding properties, which contains two zinc finger motifs that are required for hetero- or homo-dimerization, DNA-binding protein Ikaros is a protein that in humans is encoded by the IKZF1 gene
Immunogen: Amino acids LKEEHRAYDLLRAASENSQDALRVVSTSGEQM of human IKZF1 were used as the immunogen for the IKAROS antibody
Storage: Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the IKAROS antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term
Localization: Nuclear
Properties: C, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24°
Gene target: IKAROS / IKZF1
Short name: IKAROS Antibody / IKZF1
Technique: antibodies against human proteins, antibodies for, Antibody
Alternative name: IKAROS (Antibody to) / IKAROS family zinc finger 1 (Ikaros)
Alternative technique: antibodies
Alternative to gene target: BT, DNA-templated and biological process this GO :0006355 and regulation of transcription, DNA-templated and biological process this GO :0007049 and cell cycle and biological process this GO :0007498 and mesoderm development and biological process this GO :0016568 and chromatin modification and biological process this GO :0030097 and hemopoiesis and biological process this GO :0030183 and B cell differentiation and biological process this GO :0030217 and T cell differentiation and biological process this GO :0030900 and forebrain development and biological process this GO :0040018 and positive regulation of multicellular organism growth and biological process this GO :0043565 and sequence-specific DNA binding and molecular function this GO :0045660 and positive regulation of neutrophil differentiation and biological process this GO :0045892 and negative regulation of transcription, DNA-templated and biological process this GO :0045893 and positive regulation of transcription, DNA-templated and biological process this GO :0045944 and positive regulation of transcription from RNA polymerase II promoter and biological process this GO :0046872 and metal ion binding and molecular function this GO :0046982 and protein heterodimerization activity and molecular function this GO :0048535 and lymph node development and biological process this GO :0048538 and thymus development and biological process this GO :0048541 and Peyer's patch development and biological process this GO :0048732 and gland development and biological process this GO :0051138 and positive regulation of NK T cell differentiation and biological process this GO :0060041 and retina development in camera-type eye and biological process, Hs, IKZF1 and IDBG-16397 and ENSG00000185811 and 10320, Ikzf1 and IDBG-150234 and ENSMUSG00000018654 and 22778, nuclei, protein heterodimerization activity, this GO :0000122 and negative regulation of transcription from RNA polymerase II promoter and biological process this GO :0001779 and natural killer cell differentiation and biological process this GO :0003677 and DNA binding and molecular function this GO :0003700 and sequence-specific DNA binding transcription factor activity and molecular function this GO :0005515 and protein binding and molecular function this GO :0005634 and nucleus and cellular component this GO :0005721 and centromeric heterochromatin and cellular component this GO :0005737 and cytoplasm and cellular component this GO :0006351 and transcription, this GO :0003677 : DNA binding, this GO :0003677 : DNA binding and also this GO :0003700 : sequence-specific DNA binding transcription factor activity and also this GO :0005515 : protein binding and also this GO :0043565 : sequence-specific DNA binding and also this GO :0046872 : metal ion binding and also this GO :0046982 : protein heterodimerization activity, this GO :0003700 : sequence-specific DNA binding transcription factor activity, this GO :0005515 : protein binding, this GO :0043565 : sequence-specific DNA binding, this GO :0046872 : metal ion binding, this GO :0046982 : protein heterodimerization activity, 54452 and IK1 and IKAROS and LyF-1 and LYF1 and PPP1R92 and PRO0758 and ZNFN1A1, 93003 and IDBG-628786 and ENSBTAG00000014016 and 541154, IKAROS family zinc finger 1 (Ikaros)
Identity: 13176
Gene: IKZF1 | More about : IKZF1
Long gene name: IKAROS family zinc finger 1
Synonyms gene: ZNFN1A1
Synonyms gene name: 1 (Ikaros) IKAROS family zinc finger 1 (Ikaros) , subfamily 1A, zinc finger protein
Synonyms: hIk-1 LyF-1 Hs, 54452 IKAROS PPP1R92
Synonyms name: protein phosphatase 1, regulatory subunit 92
Locus: 7p12, 2
Discovery year: 1999-08-23
GenBank acession: U40462
Entrez gene record: 10320
Pubmed identfication: 1439790 7935426
RefSeq identity: NM_006060
Classification: Protein phosphatase 1 regulatory subunits Zinc fingers C2H2-type
Havana BLAST/BLAT: OTTHUMG00000155907

Related Products :

AP23703PU-N anti-IKZF1 / IKAROS Antibody 0,1 mg 558 € acr human
AP23793PU-M anti-IKZF1 / IKAROS Antibody 0,5 ml 572 € acr human
AP23793PU-N anti-IKZF1 / IKAROS Antibody 1 ml 804 € acr human
AP23793PU-S anti-IKZF1 / IKAROS Antibody 0,1 ml 326 € acr human
AP52180PU-N anti-IKZF1 / IKAROS (C-term) Antibody 0,4 ml 587 € acr human
AM20273PU-M anti-IKZF1 / IKAROS (N-term) Antibody 0,5 ml 790 € acr human
AM20273PU-N anti-IKZF1 / IKAROS (N-term) Antibody 1 ml 1109 € acr human
AM20273PU-S anti-IKZF1 / IKAROS (N-term) Antibody 0,1 ml 471 € acr human
MBS421728 Goat anti-IKAROS / IKZF1 Antibody 100ug 370 € MBS Polyclonals_1 human
MBS421674 Goat anti-IKZF1 / IKAROS Antibody 100ug 370 € MBS Polyclonals_1 human
MBS243527 Goat Polyclonal to Human IKZF1 / IKAROS Antibody 50ug 597 € MBS Polyclonals_1 human
R32214 IKAROS Antibody / IKZF1 0.1mg 406 € NJS poly human
GENTAUR-58bda6a7ba6ea Human DNA-binding protein Ikaros (IKZF1) 100ug 2431 € MBS Recombinant Proteins human
GENTAUR-58bda6a8386ed Human DNA-binding protein Ikaros (IKZF1) 1000ug 2431 € MBS Recombinant Proteins human
GENTAUR-58bda6a894a5f Human DNA-binding protein Ikaros (IKZF1) 100ug 2945 € MBS Recombinant Proteins human
GENTAUR-58bda6a8f3bb1 Human DNA-binding protein Ikaros (IKZF1) 1000ug 2945 € MBS Recombinant Proteins human
GENTAUR-58be0dfbe5ee2 Anti- IKZF1 Antibody 0.06 ml 265 € MBS Polyclonals human
GENTAUR-58be0dfc3d731 Anti- IKZF1 Antibody 0.12 ml 348 € MBS Polyclonals human
GENTAUR-58be14ae115dc Anti- IKZF1 Antibody 0.06 ml 265 € MBS Polyclonals human
GENTAUR-58be14ae6e9d0 Anti- IKZF1 Antibody 0.12 ml 348 € MBS Polyclonals human
GENTAUR-58be3d2ec430f Anti- IKZF1 Antibody 100ug 393 € MBS Polyclonals human
abx216181 Anti-IKZF1 Antibody 200 μg 369 € abbex human
GWB-ML424A IKZF1 antibody 1 vial 521 € genways human
GWB-MV009I Ikzf1 antibody 1 vial 521 € genways human
GWB-MW226A Ikzf1 antibody 1 vial 521 € genways human
R33661-100UG IKZF1 Antibody 0.1mg 406 € NJS poly human
abx920378 Anti-IKZF1 siRNA inquire 50 € abbex human
LV188175 IKZF1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV) 1.0 µg DNA 322 € ABM lentivectors human
LV188176 IKZF1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-C-term-HA) 1.0 µg DNA 322 € ABM lentivectors human
LV188177 IKZF1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro) 1.0 µg DNA 322 € ABM lentivectors human