| Category: |
Antibody |
| Concentration: |
2ml sterile DI water, 5mg/ml if reconstituted with 0 |
| Form: |
Antigen affinity purified |
| Conjugation: |
Unconjugated |
| Clone: |
Polyclonal antibody |
| Recognised antigen: |
PTP4A2 |
| Host animal: |
Rabbit (Oryctolagus cuniculus) |
| Clonality: |
Polyclonal (rabbit origin) |
| Species reactivity: |
Due to limited knowledge and inability to test the antibody against all known species, Mouse (Mus musculus), Rat , we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens) |
| Tested applications: |
IHC-P, WB |
| Recommended dilutions: |
1-0, 5-1ug/ml, 5ug/ml, IHC (Paraffin): 0, Western blot: 0 |
| Notes: |
Optimal dilution of the PTP4A2 antibody should be determined by the researcher |
| Intented use: |
This PTP4A2 antibodyis to be used only for research purposes and not for diagnostics |
| Uniprot #: |
Q12974 |
| Purity: |
Antigen affinity |
| Description: |
12 and 17, Alternatively spliced transcript variants have been described, Overexpression of this gene in mammalian cells conferred a transformed phenotype, PTPs are cell signaling molecules that play regulatory roles in a variety of cellular processes, PTPs in this class contain a protein tyrosine phosphatase catalytic domain and a characteristic C-terminal prenylation motif, Related pseudogenes exist on chromosomes 11, The protein encoded by this gene belongs to a small class of the protein tyrosine phosphatase (PTP) family, This PTP has been shown to primarily associate with plasmic and endosomal membrane through its C-terminal prenylation, This PTP was found to interact with the beta-subunit of Rab geranylgeranyltransferase II (beta GGT II), and thus may function as a regulator of GGT II activity, which suggested its role in tumorigenesis, Protein tyrosine phosphatase type IVA 2 is an enzyme that in humans is encoded by the PTP4A2 gene |
| Immunogen: |
Amino acids TTLVRVCDATYDKAPVEKEGIHVLDWPFDD of human PTP4A2 were used as the immunogen for the PTP4A2 antibody |
| Storage: |
Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the PTP4A2 antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term |
| Localization: |
membrane, Cytoplasmic |
| Properties: |
C, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24° |
| Gene target: |
PTP4A2 |
| Short name: |
PTP4A2 Antibody |
| Technique: |
antibodies against human proteins, antibodies for, Antibody |
| Alternative name: |
PTP4A2 (Antibody to) |
| Alternative technique: |
antibodies |
| Identity: |
9635 |
| Gene: |
PTP4A2 |
More about : PTP4A2 |
| Long gene name: |
member 2 , protein tyrosine phosphatase type IVA |
| Synonyms gene: |
PTP4A |
| Synonyms: |
HU-PP-1 PTPCAAX2 OV-1 ptp-IV1a PRL-2 |
| Locus: |
1p35, 2 |
| Discovery year: |
1996-03-14 |
| GenBank acession: |
L48723 |
| Entrez gene record: |
8073 |
| Pubmed identfication: |
8661118 9514946 |
| RefSeq identity: |
NM_080391 |
| Classification: |
Protein tyrosine phosphatases type IVA |
| Havana BLAST/BLAT: |
OTTHUMG00000003801 |