SULT2A1 Antibody

Contact us
Catalog number: R32194
Price: 1835 €
Supplier: MBS Recombinant Proteins
Product name: SULT2A1 Antibody
Quantity: 1000ug
Other quantities: 0.1ml 263€ 100ul 630€
Related search:

More details :

Category: Antibody
Concentration: 2ml sterile DI water, 5mg/ml if reconstituted with 0
Form: Antigen affinity purified
Conjugation: Unconjugated
Clone: Polyclonal antibody
Recognised antigen: SULT2A1
Host animal: Rabbit (Oryctolagus cuniculus)
Clonality: Polyclonal (rabbit origin)
Species reactivity: Due to limited knowledge and inability to test the antibody against all known species, Mouse (Mus musculus), Rat , we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens)
Tested applications: IHC-P, WB
Recommended dilutions: 1-0, 5-1ug/ml, 5ug/ml, IHC (Paraffin): 0, Western blot: 0
Notes: Optimal dilution of the SULT2A1 antibody should be determined by the researcher
Intented use: This SULT2A1 antibodyis to be used only for research purposes and not for diagnostics
Uniprot #: Q06520
Purity: Antigen affinity
Description: It is mapped to 19q13, Sulfotransferases aid in the metabolism of drugs and endogenous compounds by converting these substances into more hydrophilic water-soluble sulfate conjugates that can be easily excreted, This gene encodes a member of the sulfotransferase family, This protein catalyzes the sulfation of steroids and bile acids in the liver and adrenal glands, also known as hydroxysteroid sulfotransferase (HST) or sulfotransferase 2A1 (ST2A1), and may have a role in the inherited adrenal androgen excess in women with polycystic ovary syndrome, is an enzyme that in humans is encoded by the SULT2A1 gene, 3, Bile salt sulfotransferase
Immunogen: Amino acids DWKNHFTVAQAEDFDKLFQEKMADLPRELFPWE of human SULT2A1 were used as the immunogen for the SULT2A1 antibody
Storage: Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the SULT2A1 antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term
Localization: Cytoplasmic
Properties: C, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24°
Gene target: SULT2A1
Short name: SULT2A1 Antibody
Technique: antibodies against human proteins, antibodies for, Antibody
Alternative name: SULT2A1 (Antibody to)
Alternative technique: antibodies
Identity: 11458
Gene: SULT2A1 | More about : SULT2A1
Long gene name: sulfotransferase family 2A member 1
Synonyms gene: STD
Synonyms gene name: 2A, cytosolic, dehydroepiandrosterone (DHEA)-preferring, member 1 , sulfotransferase family
Synonyms: DHEA-ST
Locus: 19q13, 33
Discovery year: 1994-03-03
GenBank acession: X70222
Entrez gene record: 6822
Pubmed identfication: 1588921 7736787
RefSeq identity: NM_003167
Classification: Sulfotransferases, cytosolic
Havana BLAST/BLAT: OTTHUMG00000162469

Related Products :

GENTAUR-58bdf0205524f Anti- SULT2A1 Antibody 0.06 ml 265 € MBS Polyclonals human
GENTAUR-58bdf020b9fb1 Anti- SULT2A1 Antibody 0.12 ml 348 € MBS Polyclonals human
GENTAUR-58bdf3abc39be Anti- SULT2A1 Antibody 0.12 ml 348 € MBS Polyclonals human
GENTAUR-58bdf3ac2c780 Anti- SULT2A1 Antibody 0.06 ml 265 € MBS Polyclonals human
GENTAUR-58be05c534ebb Anti- SULT2A1 Antibody 0.12 ml 348 € MBS Polyclonals human
GENTAUR-58be05c5a38dd Anti- SULT2A1 Antibody 0.06 ml 265 € MBS Polyclonals human
GENTAUR-58be416dc9041 Anti- SULT2A1 Antibody 100ug 393 € MBS Polyclonals human
GENTAUR-58be58e2e3aea Anti- SULT2A1 Antibody 100ug 387 € MBS Polyclonals human
GENTAUR-58be58e34f3d4 Anti- SULT2A1 Antibody 50ug 304 € MBS Polyclonals human
GENTAUR-58be58e55ee37 Anti- SULT2A1 Antibody 0.2 mg 558 € MBS Polyclonals human
abx216085 Anti-SULT2A1 Antibody 100 μg 311 € abbex human
AR39023PU-L anti-SULT2A1 / HST (1-285, His-tag) Antibody 0,5 mg 1138 € acr human
AR39023PU-N anti-SULT2A1 / HST (1-285, His-tag) Antibody 0,1 mg 485 € acr human
CPA2124-100ul anti-SULT2A1 / HST Antibody 0,1 ml 442 € acr human
CPA2124-200ul anti-SULT2A1 / HST Antibody 0,2 ml 688 € acr human
CPA2124-30ul anti-SULT2A1 / HST Antibody 30 Вµl 326 € acr human
AP12291PU-N anti-SULT2A1 / HST (C-term) Antibody 0,4 ml 587 € acr human
AP54105PU-N anti-SULT2A1 / HST (N-term) Antibody 0,4 ml 587 € acr human
GENTAUR-58be380f5158e SulT2A1 antibody 100ul 630 € MBS mono human
GENTAUR-58be381c2ad96 SulT2A1 antibody 100ul 630 € MBS mono human
GENTAUR-58be386e6c392 SulT2A1 antibody 100ul 630 € MBS mono human
GENTAUR-58be39e402088 SulT2A1 antibody 100ul 630 € MBS mono human
GENTAUR-58be3a929d949 SulT2A1 antibody 100ul 630 € MBS mono human
R32194 SULT2A1 Antibody 0.1mg 406 € NJS poly human
bs-5664R SULT2A1 Antibody 0.1ml 263 € Bioss Primary Unconjugated Antibodies human
MBS272857 SULT2A1 antibody [N1C3] 100ul 426 € MBS Polyclonals_1 human
abx935652 Anti-SULT2A1 siRNA 30 nmol 717 € abbex human
abx935653 Anti-SULT2A1 siRNA 30 nmol 717 € abbex human
GENTAUR-58b8190bc9c93 Macaca fascicularis Bile salt sulfotransferase (SULT2A1) 100ug 1835 € MBS Recombinant Proteins human
GENTAUR-58b8190c33a6e Macaca fascicularis Bile salt sulfotransferase (SULT2A1) 1000ug 1835 € MBS Recombinant Proteins human