| Category: |
Antibody |
| Concentration: |
2ml sterile DI water, 5mg/ml if reconstituted with 0 |
| Form: |
Antigen affinity purified |
| Conjugation: |
Unconjugated |
| Clone: |
Polyclonal antibody |
| Recognised antigen: |
SULT2A1 |
| Host animal: |
Rabbit (Oryctolagus cuniculus) |
| Clonality: |
Polyclonal (rabbit origin) |
| Species reactivity: |
Due to limited knowledge and inability to test the antibody against all known species, Mouse (Mus musculus), Rat , we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens) |
| Tested applications: |
IHC-P, WB |
| Recommended dilutions: |
1-0, 5-1ug/ml, 5ug/ml, IHC (Paraffin): 0, Western blot: 0 |
| Notes: |
Optimal dilution of the SULT2A1 antibody should be determined by the researcher |
| Intented use: |
This SULT2A1 antibodyis to be used only for research purposes and not for diagnostics |
| Uniprot #: |
Q06520 |
| Purity: |
Antigen affinity |
| Description: |
It is mapped to 19q13, Sulfotransferases aid in the metabolism of drugs and endogenous compounds by converting these substances into more hydrophilic water-soluble sulfate conjugates that can be easily excreted, This gene encodes a member of the sulfotransferase family, This protein catalyzes the sulfation of steroids and bile acids in the liver and adrenal glands, also known as hydroxysteroid sulfotransferase (HST) or sulfotransferase 2A1 (ST2A1), and may have a role in the inherited adrenal androgen excess in women with polycystic ovary syndrome, is an enzyme that in humans is encoded by the SULT2A1 gene, 3, Bile salt sulfotransferase |
| Immunogen: |
Amino acids DWKNHFTVAQAEDFDKLFQEKMADLPRELFPWE of human SULT2A1 were used as the immunogen for the SULT2A1 antibody |
| Storage: |
Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the SULT2A1 antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term |
| Localization: |
Cytoplasmic |
| Properties: |
C, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24° |
| Gene target: |
SULT2A1 |
| Short name: |
SULT2A1 Antibody |
| Technique: |
antibodies against human proteins, antibodies for, Antibody |
| Alternative name: |
SULT2A1 (Antibody to) |
| Alternative technique: |
antibodies |
| Identity: |
11458 |
| Gene: |
SULT2A1 |
More about : SULT2A1 |
| Long gene name: |
sulfotransferase family 2A member 1 |
| Synonyms gene: |
STD |
| Synonyms gene name: |
2A, cytosolic, dehydroepiandrosterone (DHEA)-preferring, member 1 , sulfotransferase family |
| Synonyms: |
DHEA-ST |
| Locus: |
19q13, 33 |
| Discovery year: |
1994-03-03 |
| GenBank acession: |
X70222 |
| Entrez gene record: |
6822 |
| Pubmed identfication: |
1588921 7736787 |
| RefSeq identity: |
NM_003167 |
| Classification: |
Sulfotransferases, cytosolic |
| Havana BLAST/BLAT: |
OTTHUMG00000162469 |