| Category: |
Antibody |
| Concentration: |
2ml sterile DI water, 5mg/ml if reconstituted with 0 |
| Form: |
Antigen affinity purified |
| Conjugation: |
Unconjugated |
| Clone: |
Polyclonal antibody |
| Recognised antigen: |
RAB11A |
| Host animal: |
Rabbit (Oryctolagus cuniculus) |
| Clonality: |
Polyclonal (rabbit origin) |
| Species reactivity: |
Due to limited knowledge and inability to test the antibody against all known species, we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens) |
| Tested applications: |
WB |
| Recommended dilutions: |
1-0, 5ug/ml, Western blot: 0 |
| Notes: |
Optimal dilution of the RAB11 antibody should be determined by the researcher |
| Intented use: |
This RAB11 antibodyis to be used only for research purposes and not for diagnostics |
| Uniprot #: |
P62491 |
| Purity: |
Antigen affinity |
| Description: |
Additionally, It has been shown to interact with RAB11FIP2, It is mapped to 15q22, RAB11A can control intracellular trafficking of the innate immune receptor TLR4, RAB11A is associated with both constitutive and regulated secretory pathways, RAB11FIP4, Rab family which plays essential roles in vesicle and granule targeting, The protein encoded by this gene belongs to the small GTPase superfamily, and RAB11FIP1 and so on, and may be involved in protein transport, and thereby also receptor signaling, 31, Ras-related protein Rab-11A is a protein that in humans is encoded by the RAB11A gene |
| Immunogen: |
Amino acids EIYRIVSQKQMSDRRENDMSPSNNVVPIHVPPTTENKPKVQ of human RAB11A were used as the immunogen for the RAB11 antibody |
| Storage: |
Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the RAB11 antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term |
| Properties: |
C, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24° |
| Gene target: |
RAB11A |
| Short name: |
RAB11A Antibody |
| Technique: |
antibodies against human proteins, antibodies for, Antibody |
| Alternative name: |
member RAS oncogene family (Antibody to), RAB11A |
| Alternative technique: |
antibodies |
| Alternative to gene target: |
Plasma membranes, RAB11A and IDBG-17737 and ENSG00000103769 and 8766, RAB11A and IDBG-645409 and ENSBTAG00000018959 and 534708, Rab11a and IDBG-176597 and ENSMUSG00000004771 and 53869, YL8, member RAS oncogene family, syntaxin binding, this GO :0000910 and cytokinesis and biological process this GO :0003924 and GTPase activity and molecular function this GO :0005515 and protein binding and molecular function this GO :0005525 and GTP binding and molecular function this GO :0005622 and intracellular and cellular component this GO :0005737 and cytoplasm and cellular component this GO :0005739 and mitochondrion and cellular component this GO :0005802 and trans- this GO lgi network and cellular component this GO :0005886 and plasma membrane and cellular component this GO :0006184 and GTP catabolic process and biological process this GO :0006833 and water transport and biological process this GO :0006886 and intracellular protein transport and biological process this GO :0006913 and nucleocytoplasmic transport and biological process this GO :0007165 and signal transduction and biological process this GO :0007264 and small GTPase mediated signal transduction and biological process this GO :0015031 and protein transport and biological process this GO :0016020 and membrane and cellular component this GO :0016192 and vesicle-mediated transport and biological process this GO :0019905 and syntaxin binding and molecular function this GO :0030133 and transport vesicle and cellular component this GO :0030424 and axon and cellular component this GO :0030659 and cytoplasmic vesicle membrane and cellular component this GO :0030670 and pha this GO cytic vesicle membrane and cellular component this GO :0031175 and neuron projection development and biological process this GO :0032154 and cleavage furrow and cellular component this GO :0032402 and melanosome transport and biological process this GO :0043234 and protein complex and cellular component this GO :0045087 and innate immune response and biological process this GO :0045335 and pha this GO cytic vesicle and cellular component this GO :0045773 and positive regulation of axon extension and biological process this GO :0048169 and regulation of long-term neuronal synaptic plasticity and biological process this GO :0048227 and plasma membrane to endosome transport and biological process this GO :0048471 and perinuclear region of cytoplasm and cellular component this GO :0051223 and regulation of protein transport and biological process this GO :0055037 and recycling endosome and cellular component this GO :0055038 and recycling endosome membrane and cellular component this GO :0055085 and transmembrane transport and biological process this GO :0070062 and extracellular vesicular exosome and cellular component this GO :0072659 and protein localization to plasma membrane and biological process, this GO :0003924 : GTPase activity, this GO :0003924 : GTPase activity and also this GO :0005515 : protein binding and also this GO :0005525 : GTP binding and also this GO :0019905 : syntaxin binding, this GO :0005515 : protein binding, this GO :0005525 : GTP binding, this GO :0019905 : syntaxin binding, RAB11A |
| Identity: |
9760 |
| Gene: |
RAB11A |
More about : RAB11A |
| Long gene name: |
RAB11A, member RAS oncogene family |
| Synonyms: |
YL8 |
| Locus: |
15q22, 31 |
| Discovery year: |
1999-02-09 |
| GenBank acession: |
X56740 |
| Entrez gene record: |
8766 |
| Pubmed identfication: |
1704119 9662449 |
| Classification: |
RAB, member RAS oncogene GTPases |
| Havana BLAST/BLAT: |
OTTHUMG00000133162 |