RAB14 Antibody

Catalog number:	R32156 Buy Now
Price:	Ask price €
Supplier:	genways bulk
Product name:	RAB14 Antibody
Quantity:	bulk
Other quantities:	1 x 1 vial 486€ 100ug 370€ 100ul 304€
Related search:	rab antibody antibodies protein oncogene synonyms need

More details Need more?:

Category:	Antibody
Concentration:	2ml sterile DI water, 5mg/ml if reconstituted with 0
Form:	Antigen affinity purified
Conjugation:	Unconjugated
Clone:	Polyclonal antibody
Recognised antigen:	RAB14
Host animal:	Rabbit (Oryctolagus cuniculus)
Clonality:	Polyclonal (rabbit origin)
Species reactivity:	Due to limited knowledge and inability to test the antibody against all known species, Rat , we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens)
Tested applications:	WB
Recommended dilutions:	1-0, 5ug/ml, Western blot: 0
Notes:	Optimal dilution of the RAB14 antibody should be determined by the researcher
Intented use:	This RAB14 antibodyis to be used only for research purposes and not for diagnostics
Uniprot #:	P61106
Purity:	Antigen affinity
Description:	It is mapped to 9q33, RAB14 belongs to the large RAB family of low molecular mass GTPases that are involved in intracellular membrane trafficking, These proteins act as molecular switches that flip between an inactive GDP-bound state and an active GTP-bound state in which they recruit downstream effector proteins onto membranes, 2 based on an alignment of the RAB14 sequence with the genomic sequence, Ras-related protein Rab-14 is a protein that in humans is encoded by the RAB14 gene
Immunogen:	Amino acids NKADLEAQRDVTYEEAKQFAEENGLLFLEA of human RAB14 were used as the immunogen for the RAB14 antibody
Storage:	Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the RAB14 antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term
Properties:	C, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24°
Gene target:	RAB14
Short name:	RAB14 Antibody
Technique:	antibodies against human proteins, antibodies for, Antibody
Alternative name:	RAB14 (Antibody to)
Alternative technique:	antibodies
Identity:	16524
Gene:	RAB14 | More about : RAB14
Long gene name:	RAB14, member RAS oncogene family
Synonyms:	FBP RAB-14
Synonyms name:	F protein-binding protein 1 bA165P4, 3 (member RAS oncogene family) small GTP binding protein RAB14
Locus:	9q33, 2
Discovery year:	2001-09-14
GenBank acession:	AF152463
Entrez gene record:	51552
Pubmed identfication:	9792283 15004230
RefSeq identity:	NM_016322
Classification:	RAB, member RAS oncogene GTPases
Havana BLAST/BLAT:	OTTHUMG00000020582

• #rab
• #antibody
• #antibodies
• #protein
• #oncogene
• #synonyms
• #need