| Category: |
Antibody |
| Concentration: |
2ml sterile DI water, 5mg/ml if reconstituted with 0 |
| Form: |
Antigen affinity purified |
| Conjugation: |
Unconjugated |
| Clone: |
Polyclonal antibody |
| Recognised antigen: |
FOXA3 |
| Host animal: |
Rabbit (Oryctolagus cuniculus) |
| Clonality: |
Polyclonal (rabbit origin) |
| Species reactivity: |
Due to limited knowledge and inability to test the antibody against all known species, Mouse (Mus musculus), Rat , we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens) |
| Tested applications: |
WB |
| Recommended dilutions: |
1-0, 5ug/ml, Western blot: 0 |
| Notes: |
Optimal dilution of the FOXA3 antibody should be determined by the researcher |
| Intented use: |
This FOXA3 antibodyis to be used only for research purposes and not for diagnostics |
| Uniprot #: |
P55318 |
| Purity: |
Antigen affinity |
| Description: |
HNF-3G is a member of the forkhead class of DNA-binding proteins, Similar family members in mice have roles in the regulation of metabolism and in the differentiation of the pancreas and liver, The crystal structure of a similar protein in rat has been resolved, These hepatocyte nuclear factors are transcriptional activators for liver-specific transcripts such as albumin and transthyretin, This gene is mapped to 19q13, also known as forkhead box protein A3 (FOXA3) or transcription factor 3G (TCF-3G), and they also interact with chromatin, is a protein that in humans is encoded by the FOXA3 gene, 32, Hepatocyte nuclear factor 3-gamma (HNF-3G) |
| Immunogen: |
Amino acids ELKLDAPYNFNHPFSINNLMSEQTPAPPKLDVGF of human FOXA3 were used as the immunogen for the FOXA3 antibody |
| Storage: |
Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the FOXA3 antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term |
| Properties: |
C, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24° |
| Gene target: |
FOXA3 |
| Short name: |
FOXA3 Antibody |
| Technique: |
antibodies against human proteins, antibodies for, Antibody |
| Alternative name: |
FOXA3 (Antibody to) |
| Alternative technique: |
antibodies |
| Identity: |
5023 |
| Gene: |
FOXA3 |
More about : FOXA3 |
| Long gene name: |
forkhead box A3 |
| Synonyms gene: |
HNF3G |
| Synonyms gene name: |
gamma , hepatocyte nuclear factor 3 |
| Locus: |
19q13, 32 |
| Discovery year: |
1998-02-11 |
| GenBank acession: |
L12141 |
| Entrez gene record: |
3171 |
| Pubmed identfication: |
9119385 |
| Classification: |
Forkhead boxes |
| Havana BLAST/BLAT: |
OTTHUMG00000182484 |