PAR2 Antibody / F2RL1 / Thrombin Receptor-like 1

Contact us
Catalog number: R32144
Price: 322 €
Supplier: ABM lentivectors
Product name: PAR2 Antibody / F2RL1 / Thrombin Receptor-like 1
Quantity: 1.0 µg DNA
Related search:

More details :

Category: Antibody
Concentration: 2ml sterile DI water, 5mg/ml if reconstituted with 0
Form: Antigen affinity purified
Conjugation: Unconjugated
Clone: Polyclonal antibody
Recognised antigen: PAR2 / F2RL1 / Thrombin Receptor-like 1
Host animal: Rabbit (Oryctolagus cuniculus)
Clonality: Polyclonal (rabbit origin)
Species reactivity: Due to limited knowledge and inability to test the antibody against all known species, we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens)
Tested applications: WB
Recommended dilutions: 1-0, 5ug/ml, Western blot: 0
Notes: Optimal dilution of the PAR2 antibody should be determined by the researcher
Intented use: This PAR2 antibodyis to be used only for research purposes and not for diagnostics
Uniprot #: P55085
Purity: Antigen affinity
Description: Additionally, F2RL1 is a member of the large family of 7-transmembrane-region receptors that couple to guanosine-nucleotide-binding proteins, F2RL1 is also a member of the protease-activated receptor family, It is activated by proteolytic cleavage of its extracellular amino terminus, It is activated by trypsin, PAR2 modulates inflammatory responses and acts as a sensor for proteolytic enzymes generated during infection, The F2RL1 gene contains two exons and is widely expressed in human tissues, The new amino terminus functions as a tethered ligand and activates the receptor, also known ascoagulation factor II (thrombin) receptor-like 1 (F2RL1) or G-protein coupled receptor 11 (GPR11), but not by thrombin, is a protein that in humans is encoded by the F2RL1 gene, Protease activated receptor 2 (PAR2)
Immunogen: Amino acids HDFRDHAKNALLCRSVRTVKQMQVSLTSKKHSRKS of human F2RL1/PAR2 were used as the immunogen for the PAR2 antibody
Storage: Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the PAR2 antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term
Properties: C, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24°
Gene target: PAR2 / F2RL1 / Thrombin Receptor-like 1
Short name: PAR2 Antibody / F2RL1 / Thrombin Receptor-like 1
Technique: antibodies against human proteins, antibodies for, Antibody
Alternative name: PAR2 (Antibody to) / coagulation factor II (thrombin) receptor-like 1 / Thrombin Receptor-like 1
Alternative technique: antibodies
Alternative to gene target: BT, F2RL1 and IDBG-29713 and ENSG00000164251 and 2150, F2rl1 and IDBG-173973 and ENSMUSG00000021678 and 14063, G-protein beta-subunit binding, GPR11 and PAR2, Plasma membranes, engulfment and biological process this GO :0061028 and establishment of endothelial barrier and biological process this GO :0070374 and positive regulation of ERK1 and ERK2 cascade and biological process this GO :0070493 and thrombin receptor signaling pathway and biological process this GO :0070661 and leukocyte proliferation and biological process this GO :0070963 and positive regulation of neutrophil mediated killing of gram-negative bacterium and biological process this GO :0072608 and interleukin-10 secretion and biological process this GO :0072643 and interferon-gamma secretion and biological process this GO :0090195 and chemokine secretion and biological process this GO :0090198 and negative regulation of chemokine secretion and biological process this GO :0097029 and mature dendritic cell differentiation and biological process this GO :1900135 and positive regulation of renin secretion into blood stream and biological process this GO :2000484 and positive regulation of interleukin-8 secretion and biological process this GO :2000778 and positive regulation of interleukin-6 secretion and biological process, this GO :0001965 and G-protein alpha-subunit binding and molecular function this GO :0002286 and T cell activation involved in immune response and biological process this GO :0002690 and positive regulation of leukocyte chemotaxis and biological process this GO :0002741 and positive regulation of cytokine secretion involved in immune response and biological process this GO :0003104 and positive regulation of glomerular filtration and biological process this GO :0004872 and receptor activity and molecular function this GO :0004930 and G-protein coupled receptor activity and molecular function this GO :0005102 and receptor binding and molecular function this GO :0005515 and protein binding and molecular function this GO :0005794 and this GO lgi apparatus and cellular component this GO :0005886 and plasma membrane and cellular component this GO :0005887 and integral component of plasma membrane and cellular component this GO :0006954 and inflammatory response and biological process this GO :0007186 and G-protein coupled receptor signaling pathway and biological process this GO :0007204 and positive regulation of cytosolic calcium ion concentration and biological process this GO :0007596 and blood coagulation and biological process this GO :0010804 and negative regulation of tumor necrosis factor-mediated signaling pathway and biological process this GO :0014068 and positive regulation of phosphatidylinositol 3-kinase signaling and biological process this GO :0015057 and thrombin receptor activity and molecular function this GO :0016021 and integral component of membrane and cellular component this GO :0030193 and regulation of blood coagulation and biological process this GO :0030335 and positive regulation of cell migration and biological process this GO :0030836 and positive regulation of actin filament depolymerization and biological process this GO :0031143 and pseudopodium and cellular component this GO :0031274 and positive regulation of pseudopodium assembly and biological process this GO :0031681 and G-protein beta-subunit binding and molecular function this GO :0032930 and positive regulation of superoxide anion generation and biological process this GO :0034137 and positive regulation of toll-like receptor 2 signaling pathway and biological process this GO :0034140 and negative regulation of toll-like receptor 3 signaling pathway and biological process this GO :0034141 and positive regulation of toll-like receptor 3 signaling pathway and biological process this GO :0034145 and positive regulation of toll-like receptor 4 signaling pathway and biological process this GO :0035025 and positive regulation of Rho protein signal transduction and biological process this GO :0035926 and chemokine (C-C motif) ligand 2 secretion and biological process this GO :0042119 and neutrophil activation and biological process this GO :0043122 and regulation of I-kappaB kinase/NF-kappaB signaling and biological process this GO :0043123 and positive regulation of I-kappaB kinase/NF-kappaB signaling and biological process this GO :0043311 and positive regulation of eosinophil degranulation and biological process this GO :0045087 and innate immune response and biological process this GO :0045909 and positive regulation of vasodilation and biological process this GO :0045944 and positive regulation of transcription from RNA polymerase II promoter and biological process this GO :0046328 and regulation of JNK cascade and biological process this GO :0046329 and negative regulation of JNK cascade and biological process this GO :0046330 and positive regulation of JNK cascade and biological process this GO :0050702 and interleukin-1 beta secretion and biological process this GO :0050900 and leukocyte migration and biological process this GO :0050921 and positive regulation of chemotaxis and biological process this GO :0050927 and positive regulation of positive chemotaxis and biological process this GO :0051607 and defense response to virus and biological process this GO :0060100 and positive regulation of pha this GO cytosis, this GO :0001965 : G-protein alpha-subunit binding, this GO :0001965 : G-protein alpha-subunit binding and also this GO :0004872 : receptor activity and also this GO :0004930 : G-protein coupled receptor activity and also this GO :0005102 : receptor binding and also this GO :0005515 : protein binding and also this GO :0015057 : thrombin receptor activity and also this GO :0031681 : G-protein beta-subunit binding, this GO :0004872 : receptor activity, this GO :0004930 : G-protein coupled receptor activity, this GO :0005102 : receptor binding, this GO :0005515 : protein binding, this GO :0015057 : thrombin receptor activity, this GO :0031681 : G-protein beta-subunit binding, 28745 and IDBG-645161 and ENSBTAG00000034848 and 526525, coagulation factor II (thrombin) receptor-like 1
Identity: 3538
Gene: F2RL1 | More about : F2RL1
Long gene name: F2R like trypsin receptor 1
Synonyms gene: GPR11
Synonyms gene name: coagulation factor II (thrombin) receptor-like 1
Synonyms: PAR2
Synonyms name: proteinase-activated receptor-2
Locus: 5q13, 3
Discovery year: 1997-10-27
GenBank acession: BC018130
Entrez gene record: 2150
Pubmed identfication: 7937743 7556175
RefSeq identity: NM_005242
Classification: F2R receptors
Havana BLAST/BLAT: OTTHUMG00000102118

Related Products :

R32144 PAR2 Antibody / F2RL1 / Thrombin Receptor-like 1 0.1mg 406 € NJS poly human
MBS243495 Anti-Human F2RL1 / PAR2 Antibody 50ug 597 € MBS Polyclonals_1 human
MBS242971 Anti-Human F2RL1 / PAR2 50ug 597 € MBS Polyclonals_1 human
MBS244406 Anti-Human F2RL1 / PAR2 50ug 597 € MBS Polyclonals_1 human
MBS613864 Pregnane X Receptor (PXR, BXR, Nuclear Receptor Subfamily 1 Group I Member 2, NR1I2, ONR1, PAR1, PAR2, PAR, PARq, PRR, SAR, Steroid and Xenobiotic Receptor, SXR) Antibody 0.05 ml 641 € MBS Polyclonals_1 human
AE44946HU-48 ELISA test for Human Proteinase-activated receptor 2 (F2RL1) 1x plate of 48 wells 373 € abebio human
AE44946HU-96 Human Proteinase-activated receptor 2 (F2RL1) ELISA Kit 1x plate of 96 wells 612 € abebio human
HYB109-03 Thrombin, Hirudin, NO X w/pro-thrombin, Clone: 109-03, Mouse Monoclonal antibody-Human; ELISA/WB 0.2mg 1234 € accurate-monoclonals human
HYB109-04 Thrombin, Hirudin, NO X w/pro-thrombin, Clone: 109-04, Mouse Monoclonal antibody-Human; ELISA/WB 0.2mg 1234 € accurate-monoclonals human
GENTAUR-58bdcea69be9c Anti- Protease Activated Receptor 2 (PAR2) Antibody 100ug 453 € MBS Polyclonals human
GENTAUR-58bdcea6edfe9 Anti- Protease Activated Receptor 2 (PAR2) Antibody 50ug 354 € MBS Polyclonals human
GENTAUR-58bdd37da40de Anti- Protease Activated Receptor 2 (PAR2) Antibody 100ug 486 € MBS Polyclonals human
GENTAUR-58bdd7f628dab Anti- Protease Activated Receptor 2 (PAR2) Antibody 100ug 520 € MBS Polyclonals human
abx570110 Anti-Rat Protease Activated Receptor 2 (PAR2) ELISA Kit inquire 50 € abbex rat
DL-PAR2-Hu Human Protease Activated Receptor 2 PAR2 ELISA Kit 96T 846 € DL elisas human
DL-PAR2-Mu Mouse Protease Activated Receptor 2 PAR2 ELISA Kit 96T 869 € DL elisas mouse
EKU06871 Protease Activated Receptor 2 (PAR2) ELISA kit 1 plate of 96 wells 745 € Biomatik ELISA kits human
EKU06872 Protease Activated Receptor 2 (PAR2) ELISA kit 1 plate of 96 wells 764 € Biomatik ELISA kits human
EKU06873 Protease Activated Receptor 2 (PAR2) ELISA kit 1 plate of 96 wells 804 € Biomatik ELISA kits human
DL-PAR2-Ra Rat Protease Activated Receptor 2 PAR2 ELISA Kit 96T 904 € DL elisas rat
GENTAUR-58bdeebe386bf Anti- F2RL1 Antibody 0.06 ml 265 € MBS Polyclonals human
GENTAUR-58bdeebe722f1 Anti- F2RL1 Antibody 0.12 ml 348 € MBS Polyclonals human
GWB-MV830B F2RL1 antibody 1 vial 521 € genways human
abx901807 Anti-F2RL1 siRNA inquire 50 € abbex human
abx915873 Anti-F2RL1 siRNA 15 nmol 528 € abbex human
abx915874 Anti-F2RL1 siRNA inquire 50 € abbex human
LV152089 F2RL1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV) 1.0 µg DNA 322 € ABM lentivectors human
LV152090 F2RL1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-C-term-HA) 1.0 µg DNA 322 € ABM lentivectors human
LV152091 F2RL1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro) 1.0 µg DNA 322 € ABM lentivectors human
LV152092 F2RL1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro) 1.0 µg DNA 322 € ABM lentivectors human