| Category: |
Antibody |
| Concentration: |
2ml sterile DI water, 5mg/ml if reconstituted with 0 |
| Form: |
Antigen affinity purified |
| Conjugation: |
Unconjugated |
| Clone: |
Polyclonal antibody |
| Recognised antigen: |
PAR2 / F2RL1 / Thrombin Receptor-like 1 |
| Host animal: |
Rabbit (Oryctolagus cuniculus) |
| Clonality: |
Polyclonal (rabbit origin) |
| Species reactivity: |
Due to limited knowledge and inability to test the antibody against all known species, we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens) |
| Tested applications: |
WB |
| Recommended dilutions: |
1-0, 5ug/ml, Western blot: 0 |
| Notes: |
Optimal dilution of the PAR2 antibody should be determined by the researcher |
| Intented use: |
This PAR2 antibodyis to be used only for research purposes and not for diagnostics |
| Uniprot #: |
P55085 |
| Purity: |
Antigen affinity |
| Description: |
Additionally, F2RL1 is a member of the large family of 7-transmembrane-region receptors that couple to guanosine-nucleotide-binding proteins, F2RL1 is also a member of the protease-activated receptor family, It is activated by proteolytic cleavage of its extracellular amino terminus, It is activated by trypsin, PAR2 modulates inflammatory responses and acts as a sensor for proteolytic enzymes generated during infection, The F2RL1 gene contains two exons and is widely expressed in human tissues, The new amino terminus functions as a tethered ligand and activates the receptor, also known ascoagulation factor II (thrombin) receptor-like 1 (F2RL1) or G-protein coupled receptor 11 (GPR11), but not by thrombin, is a protein that in humans is encoded by the F2RL1 gene, Protease activated receptor 2 (PAR2) |
| Immunogen: |
Amino acids HDFRDHAKNALLCRSVRTVKQMQVSLTSKKHSRKS of human F2RL1/PAR2 were used as the immunogen for the PAR2 antibody |
| Storage: |
Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the PAR2 antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term |
| Properties: |
C, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24° |
| Gene target: |
PAR2 / F2RL1 / Thrombin Receptor-like 1 |
| Short name: |
PAR2 Antibody / F2RL1 / Thrombin Receptor-like 1 |
| Technique: |
antibodies against human proteins, antibodies for, Antibody |
| Alternative name: |
PAR2 (Antibody to) / coagulation factor II (thrombin) receptor-like 1 / Thrombin Receptor-like 1 |
| Alternative technique: |
antibodies |
| Alternative to gene target: |
BT, F2RL1 and IDBG-29713 and ENSG00000164251 and 2150, F2rl1 and IDBG-173973 and ENSMUSG00000021678 and 14063, G-protein beta-subunit binding, GPR11 and PAR2, Plasma membranes, engulfment and biological process this GO :0061028 and establishment of endothelial barrier and biological process this GO :0070374 and positive regulation of ERK1 and ERK2 cascade and biological process this GO :0070493 and thrombin receptor signaling pathway and biological process this GO :0070661 and leukocyte proliferation and biological process this GO :0070963 and positive regulation of neutrophil mediated killing of gram-negative bacterium and biological process this GO :0072608 and interleukin-10 secretion and biological process this GO :0072643 and interferon-gamma secretion and biological process this GO :0090195 and chemokine secretion and biological process this GO :0090198 and negative regulation of chemokine secretion and biological process this GO :0097029 and mature dendritic cell differentiation and biological process this GO :1900135 and positive regulation of renin secretion into blood stream and biological process this GO :2000484 and positive regulation of interleukin-8 secretion and biological process this GO :2000778 and positive regulation of interleukin-6 secretion and biological process, this GO :0001965 and G-protein alpha-subunit binding and molecular function this GO :0002286 and T cell activation involved in immune response and biological process this GO :0002690 and positive regulation of leukocyte chemotaxis and biological process this GO :0002741 and positive regulation of cytokine secretion involved in immune response and biological process this GO :0003104 and positive regulation of glomerular filtration and biological process this GO :0004872 and receptor activity and molecular function this GO :0004930 and G-protein coupled receptor activity and molecular function this GO :0005102 and receptor binding and molecular function this GO :0005515 and protein binding and molecular function this GO :0005794 and this GO lgi apparatus and cellular component this GO :0005886 and plasma membrane and cellular component this GO :0005887 and integral component of plasma membrane and cellular component this GO :0006954 and inflammatory response and biological process this GO :0007186 and G-protein coupled receptor signaling pathway and biological process this GO :0007204 and positive regulation of cytosolic calcium ion concentration and biological process this GO :0007596 and blood coagulation and biological process this GO :0010804 and negative regulation of tumor necrosis factor-mediated signaling pathway and biological process this GO :0014068 and positive regulation of phosphatidylinositol 3-kinase signaling and biological process this GO :0015057 and thrombin receptor activity and molecular function this GO :0016021 and integral component of membrane and cellular component this GO :0030193 and regulation of blood coagulation and biological process this GO :0030335 and positive regulation of cell migration and biological process this GO :0030836 and positive regulation of actin filament depolymerization and biological process this GO :0031143 and pseudopodium and cellular component this GO :0031274 and positive regulation of pseudopodium assembly and biological process this GO :0031681 and G-protein beta-subunit binding and molecular function this GO :0032930 and positive regulation of superoxide anion generation and biological process this GO :0034137 and positive regulation of toll-like receptor 2 signaling pathway and biological process this GO :0034140 and negative regulation of toll-like receptor 3 signaling pathway and biological process this GO :0034141 and positive regulation of toll-like receptor 3 signaling pathway and biological process this GO :0034145 and positive regulation of toll-like receptor 4 signaling pathway and biological process this GO :0035025 and positive regulation of Rho protein signal transduction and biological process this GO :0035926 and chemokine (C-C motif) ligand 2 secretion and biological process this GO :0042119 and neutrophil activation and biological process this GO :0043122 and regulation of I-kappaB kinase/NF-kappaB signaling and biological process this GO :0043123 and positive regulation of I-kappaB kinase/NF-kappaB signaling and biological process this GO :0043311 and positive regulation of eosinophil degranulation and biological process this GO :0045087 and innate immune response and biological process this GO :0045909 and positive regulation of vasodilation and biological process this GO :0045944 and positive regulation of transcription from RNA polymerase II promoter and biological process this GO :0046328 and regulation of JNK cascade and biological process this GO :0046329 and negative regulation of JNK cascade and biological process this GO :0046330 and positive regulation of JNK cascade and biological process this GO :0050702 and interleukin-1 beta secretion and biological process this GO :0050900 and leukocyte migration and biological process this GO :0050921 and positive regulation of chemotaxis and biological process this GO :0050927 and positive regulation of positive chemotaxis and biological process this GO :0051607 and defense response to virus and biological process this GO :0060100 and positive regulation of pha this GO cytosis, this GO :0001965 : G-protein alpha-subunit binding, this GO :0001965 : G-protein alpha-subunit binding and also this GO :0004872 : receptor activity and also this GO :0004930 : G-protein coupled receptor activity and also this GO :0005102 : receptor binding and also this GO :0005515 : protein binding and also this GO :0015057 : thrombin receptor activity and also this GO :0031681 : G-protein beta-subunit binding, this GO :0004872 : receptor activity, this GO :0004930 : G-protein coupled receptor activity, this GO :0005102 : receptor binding, this GO :0005515 : protein binding, this GO :0015057 : thrombin receptor activity, this GO :0031681 : G-protein beta-subunit binding, 28745 and IDBG-645161 and ENSBTAG00000034848 and 526525, coagulation factor II (thrombin) receptor-like 1 |
| Identity: |
3538 |
| Gene: |
F2RL1 |
More about : F2RL1 |
| Long gene name: |
F2R like trypsin receptor 1 |
| Synonyms gene: |
GPR11 |
| Synonyms gene name: |
coagulation factor II (thrombin) receptor-like 1 |
| Synonyms: |
PAR2 |
| Synonyms name: |
proteinase-activated receptor-2 |
| Locus: |
5q13, 3 |
| Discovery year: |
1997-10-27 |
| GenBank acession: |
BC018130 |
| Entrez gene record: |
2150 |
| Pubmed identfication: |
7937743 7556175 |
| RefSeq identity: |
NM_005242 |
| Classification: |
F2R receptors |
| Havana BLAST/BLAT: |
OTTHUMG00000102118 |