| Category: |
Antibody |
| Concentration: |
2ml sterile DI water, 5mg/ml if reconstituted with 0 |
| Form: |
Antigen affinity purified |
| Conjugation: |
Unconjugated |
| Clone: |
Polyclonal antibody |
| Recognised antigen: |
Eph Receptor B1 / EphB1 |
| Host animal: |
Rabbit (Oryctolagus cuniculus) |
| Clonality: |
Polyclonal (rabbit origin) |
| Species reactivity: |
Due to limited knowledge and inability to test the antibody against all known species, we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens) |
| Tested applications: |
IHC-P, WB |
| Recommended dilutions: |
1-0, 5-1ug/ml, 5ug/ml, IHC (Paraffin): 0, Western blot: 0 |
| Notes: |
Optimal dilution of the EPHB1 antibody should be determined by the researcher |
| Intented use: |
This EPHB1antibodyis to be used only for research purposes and not for diagnostics |
| Uniprot #: |
P54762 |
| Purity: |
Antigen affinity |
| Description: |
Based on their structures and sequence relationships, Ephrin receptors and their ligands, Ephrin receptors make up the largest subgroup of the receptor tyrosine kinase (RTK) family, The Eph family of receptors are divided into 2 groups based on the similarity of their extracellular domain sequences and their affinities for binding ephrin-A and ephrin-B ligands, The protein encoded by this gene is a receptor for ephrin-B family members, and the ephrin-B (EFNB) class, ephrins are divided into the ephrin-A (EFNA) class, mediate numerous developmental processes, particularly in the nervous system, the ephrins, which are anchored to the membrane by a glycosylphosphatidylinositol linkage, which are transmembrane proteins, Ephrin type-B receptor 1 is a protein that in humans is encoded by the EPHB1 gene |
| Immunogen: |
Amino acids RTYQVCNVFEPNQNNWLLTTFINRRGAHRIYTE of human Eph receptor B1 were used as the immunogen for the EPHB1 antibody |
| Storage: |
Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the EPHB1 antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term |
| Localization: |
membrane, Cytoplasmic |
| Properties: |
C, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24° |
| Gene target: |
Eph Receptor B1 / EphB1 |
| Short name: |
Eph Receptor B1 Antibody / EphB1 |
| Technique: |
antibodies against human proteins, antibodies for, Antibody |
| Alternative name: |
Eph Receptor B1 (Antibody to) / EphB1 |
| Alternative technique: |
antibodies |