Eph Receptor B1 Antibody / EphB1

Contact us
Catalog number: R32141
Price: 332 €
Supplier: Bioss Primary Conjugated Antibodies.
Product name: Eph Receptor B1 Antibody / EphB1
Quantity: 100ul
Related search:

More details :

Category: Antibody
Concentration: 2ml sterile DI water, 5mg/ml if reconstituted with 0
Form: Antigen affinity purified
Conjugation: Unconjugated
Clone: Polyclonal antibody
Recognised antigen: Eph Receptor B1 / EphB1
Host animal: Rabbit (Oryctolagus cuniculus)
Clonality: Polyclonal (rabbit origin)
Species reactivity: Due to limited knowledge and inability to test the antibody against all known species, we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens)
Tested applications: IHC-P, WB
Recommended dilutions: 1-0, 5-1ug/ml, 5ug/ml, IHC (Paraffin): 0, Western blot: 0
Notes: Optimal dilution of the EPHB1 antibody should be determined by the researcher
Intented use: This EPHB1antibodyis to be used only for research purposes and not for diagnostics
Uniprot #: P54762
Purity: Antigen affinity
Description: Based on their structures and sequence relationships, Ephrin receptors and their ligands, Ephrin receptors make up the largest subgroup of the receptor tyrosine kinase (RTK) family, The Eph family of receptors are divided into 2 groups based on the similarity of their extracellular domain sequences and their affinities for binding ephrin-A and ephrin-B ligands, The protein encoded by this gene is a receptor for ephrin-B family members, and the ephrin-B (EFNB) class, ephrins are divided into the ephrin-A (EFNA) class, mediate numerous developmental processes, particularly in the nervous system, the ephrins, which are anchored to the membrane by a glycosylphosphatidylinositol linkage, which are transmembrane proteins, Ephrin type-B receptor 1 is a protein that in humans is encoded by the EPHB1 gene
Immunogen: Amino acids RTYQVCNVFEPNQNNWLLTTFINRRGAHRIYTE of human Eph receptor B1 were used as the immunogen for the EPHB1 antibody
Storage: Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the EPHB1 antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term
Localization: membrane, Cytoplasmic
Properties: C, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24°
Gene target: Eph Receptor B1 / EphB1
Short name: Eph Receptor B1 Antibody / EphB1
Technique: antibodies against human proteins, antibodies for, Antibody
Alternative name: Eph Receptor B1 (Antibody to) / EphB1
Alternative technique: antibodies

Related Products :

MBS623300 EphA4 (Ephrin Receptor Eph A4, Ephrin Receptor EphA4, Ephrin Type A Receptor 4, EPH Receptor A4, Eph A4, EPH-like Kinase 8, EK8, HEK8, Receptor Protein Tyrosine Kinase HEK8, SEK, TYRO1 Protein Tyrosine Kinase, Tyrosine Protein Kinase Receptor SEK, Tyrosin Antibody 50ug 928 € MBS Polyclonals_1 human
MBS618949 EPHB2 (Ephrin Type-B Receptor 2, Tyrosine-protein Kinase Receptor EPH-3, DRT, Receptor Protein-Tyrosine Kinase HEK5, ERK, EPH-like Kinase 5, EK5, Tyrosine-protein Kinase TYRO5, Renal Carcinoma Antigen NY-REN-47, DRT, EPHT3, EPTH3, ERK, HEK5, TYRO5) 100ug 735 € MBS Polyclonals_1 human
MBS624025 EphB2, NT (Ephrin Type-B Receptor 2, Tyrosine-protein Kinase Receptor EPH-3, DRT, Receptor Protein-Tyrosine Kinase HEK5, ERK, EPH-like Kinase 5, EK5, Tyrosine-protein Kinase TYRO5, Renal Carcinoma Antigen NY-REN-47, DRT, EPHT3, EPTH3, ERK, HEK5, TYRO5) Antibody 200ul 603 € MBS Polyclonals_1 human
MBS615500 Ephrin B3 (EFNB3, Ephrin B3 (EFL6, EPH-related receptor transmembrane ligand ELK-L3, EPH-related receptor tyrosine kinase ligand 8, Ephrin-B3, EPLG8, LERK8) Antibody 100ug 663 € MBS Polyclonals_1 human
R32141 Eph Receptor B1 Antibody / EphB1 0.1mg 406 € NJS poly human
MBS616065 EphA2 Receptor (Ephrin A2 Receptor, EphA2, EPHA2, EPH Receptor A2) Antibody 100ug 735 € MBS Polyclonals_1 human
MBS619539 Orexin 1 Receptor (Orexin Receptor 1, Orexin Receptor-1, Orexin Receptor Type 1, OX1R, Hypocretin 1 Receptor, Hypocretin Receptor 1, Hypocretin Receptor-1, Hypocretin Receptor Type 1, HCRTR1) 100ug 735 € MBS Polyclonals_1 human
MBS613591 EphA7 (HEK11, EPA7, Ephrin Type-A Receptor 7 Precursor, Tyrosine Protein Kinase Receptor EHK-3, Eph Homology Kinase-3) Antibody 100ul 647 € MBS Polyclonals_1 human
MBS624160 EphA3, CT (Ephrin Type-A Receptor 3, Tyrosine-protein Kinase Receptor ETK1, HEK, EPH-like Kinase 4, HEK4, EK4, Tyrosine-protein Kinase TYRO4, ETK, ETK1, HEK, TYRO4) Antibody 200ul 603 € MBS Polyclonals_1 human
MBS624103 EphA4, CT (Ephrin Type-A Receptor 4, Tyrosine-protein Kinase Receptor SEK, HEK8, EPH-like Kinase 8, EK8, Tyrosine-protein Kinase TYRO1, HEK8, SEK, TYRO1) Antibody 200ul 603 € MBS Polyclonals_1 human
CD11 Recombinant Human Ephrin B Receptor 1, EphB1 (C-Fc) 10 µg 202 € novo human
C871 Recombinant Human Ephrin B Receptor 1, EphB1 (ICD, C-6His) 1 mg 2283 € novo human
MBS622505 Orexin 1 Receptor (Orexin Receptor 1, Orexin Receptor-1, Orexin Receptor Type 1, OX1R, Ox-1-R, Ox1-R, Hypocretin 1 Receptor, Hypocretin Receptor 1, Hypocretin Receptor-1, Hypocretin Receptor Type 1, HCRTR1) Antibody 100ug 652 € MBS Polyclonals_1 human
GWB-54EFF5 Eph-related Receptor Tyrosine Kinase Ligand (EFNA4) Rabbit antibody to or anti-Human Polyclonal antibody 1 x 1 vial 648 € genways human
abx137439 Anti-EPH receptor A2 Antibody 20 µg 340 € abbex human
MBS241685 Anti-Human EPHA2 / EPH Receptor A2 Antibody 50ug 597 € MBS Polyclonals_1 human
MBS248574 Anti-Human EPHA3 / EPH Receptor A3 Antibody 200ul 597 € MBS Polyclonals_1 human
MBS240029 Anti-Human EPHA4 / EPH Receptor A4 Antibody 50ug 597 € MBS Polyclonals_1 human
MBS242980 Anti-Human EPHA4 / EPH Receptor A4 Antibody 50ug 597 € MBS Polyclonals_1 human
MBS243384 Anti-Human EPHA4 / EPH Receptor A4 Antibody 50ug 597 € MBS Polyclonals_1 human
MBS244215 Anti-Human EPHB2 / EPH Receptor B2 Antibody 50ug 597 € MBS Polyclonals_1 human
PEPHAR4-440AP anti-Phospho-Eph receptor A4 Antibody 100 µg 456 € fabgen human
PEPHAR4-BIOTIN anti-Phospho-Eph receptor A4 Antibody BIOTIN 100 µg 508 € fabgen human
PEPHAR4-FITC anti-Phospho-Eph receptor A4 Antibody FITC 100 µg 508 € fabgen human
MBS618897 ELF1 (E74-like Factor 1, DNA Binding Protein ELF 1, EPH Related Receptor Tyrosine Kinase Ligand 6, LERK 6) Antibody 100ug 735 € MBS Polyclonals_1 human
bs-7553R-A350 Eph receptor A2+A3+A4 Antibody, ALEXA FLUOR 350 100ul 332 € Bioss Primary Conjugated Antibodies. human
bs-7553R-A488 Eph receptor A2+A3+A4 Antibody, ALEXA FLUOR 488 100ul 332 € Bioss Primary Conjugated Antibodies. human
bs-7553R-A555 Eph receptor A2+A3+A4 Antibody, ALEXA FLUOR 555 100ul 332 € Bioss Primary Conjugated Antibodies. human
bs-7553R-A594 Eph receptor A2+A3+A4 Antibody, ALEXA FLUOR 594 100ul 332 € Bioss Primary Conjugated Antibodies. human
bs-7553R-A647 Eph receptor A2+A3+A4 Antibody, ALEXA FLUOR 647 100ul 332 € Bioss Primary Conjugated Antibodies. human