| Category: |
Antibody |
| Concentration: |
2ml sterile DI water, 5mg/ml if reconstituted with 0 |
| Form: |
Antigen affinity purified |
| Conjugation: |
Unconjugated |
| Clone: |
Polyclonal antibody |
| Recognised antigen: |
LIM Kinase 2 / LIMK2 |
| Host animal: |
Rabbit (Oryctolagus cuniculus) |
| Clonality: |
Polyclonal (rabbit origin) |
| Species reactivity: |
Due to limited knowledge and inability to test the antibody against all known species, Mouse (Mus musculus) , we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens) |
| Tested applications: |
WB |
| Recommended dilutions: |
1-0, 1-0, 5ug/ml, 5ug/ml, ELISA : 0, Western blot: 0 |
| Notes: |
Optimal dilution of the LIMK2 antibody should be determined by the researcher |
| Intented use: |
This LIMK2 antibodyis to be used only for research purposes and not for diagnostics |
| Uniprot #: |
P53671 |
| Purity: |
Antigen affinity |
| Description: |
Although zinc fingers usually function by binding to DNA or RNA, At least three transcript variants encoding different isoforms have been found for this gene, It is thought that this pathway contributes to Rho-induced reorganization of the actin cytoskeleton, LIM domains are highly conserved cysteine-rich structures containing 2 zinc fingers, LIM kinase-1 and LIM kinase-2 belong to a small subfamily with a unique combination of 2 N-terminal LIM motifs and a C-terminal protein kinase domain, The protein encoded by this gene is phosphorylated and activated by ROCK, There are approximately 40 known eukaryotic LIM proteins, a downstream effector of Rho, and the encoded protein, in turn, inhibiting its actin-depolymerizing activity, phosphorylates cofilin, so named for the LIM domains they contain, the LIM motif probably mediates protein-protein interactions, LIM domain kinase 2 is an enzyme that in humans is encoded by the LIMK2 gene |
| Immunogen: |
Amino acids KLEDSFEALSLYLGELGIPLPAELEELDHTVSMQYGLTRD of human LIM Kinase 2 were used as the immunogen for the LIMK2 antibody |
| Storage: |
Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the LIMK2 antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term |
| Properties: |
C, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24° |
| Gene target: |
LIM Kinase 2 / LIMK2 |
| Short name: |
LIM Kinase 2 Antibody / LIMK2 |
| Technique: |
antibodies against human proteins, antibodies for, Antibody |
| Alternative name: |
LIM phosphorylation catalyst 2 (Antibody to) / LIMK2 |
| Alternative technique: |
antibodies |
| Identity: |
6614 |
| Gene: |
LIMK2 |
More about : LIMK2 |
| Long gene name: |
LIM domain kinase 2 |
| Locus: |
22q12, 2 |
| Discovery year: |
1997-08-28 |
| GenBank acession: |
D45906 |
| Entrez gene record: |
3985 |
| Pubmed identfication: |
8537403 10591208 |
| RefSeq identity: |
NM_016733 |
| Classification: |
LIM domain containing PDZ domain containing |
| Havana BLAST/BLAT: |
OTTHUMG00000151251 |