| Category: |
Antibody |
| Concentration: |
2ml sterile DI water, 5mg/ml if reconstituted with 0 |
| Form: |
Antigen affinity purified |
| Conjugation: |
Unconjugated |
| Clone: |
Polyclonal antibody |
| Recognised antigen: |
APLP1 |
| Host animal: |
Rabbit (Oryctolagus cuniculus) |
| Clonality: |
Polyclonal (rabbit origin) |
| Species reactivity: |
Due to limited knowledge and inability to test the antibody against all known species, Mouse (Mus musculus), Rat , we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens) |
| Tested applications: |
IHC-P, WB |
| Recommended dilutions: |
1-0, 5-1ug/ml, 5ug/ml, IHC (Paraffin): 0, Western blot: 0 |
| Notes: |
Optimal dilution of the APLP1 antibody should be determined by the researcher |
| Intented use: |
This APLP1 antibodyis to be used only for research purposes and not for diagnostics |
| Uniprot #: |
P51693 |
| Purity: |
Antigen affinity |
| Description: |
APLP1 has been considered a candidate gene for CNF, APLP1 is predominantly expressed in brain, All exon regions of the gene were amplified by the polymerase chain reaction and sequenced from DNA of CNF patients, No differences were observed between CNF patients and controls, The gene is 11, The human gene has been mapped to chromosomal region 19q13, particularly in the cerebral cortex postsynaptic density, suggesting that mutations in APLP1 are not involved in the etiology of CNF, which has been shown to be involved in the pathogenesis of Alzheimer's disease, whose gene is homologous to the APP gene, 1, 8 kb long and contains 17 exons, Amyloid-precursor-like protein 1 (APLP1) is a membrane-associated glycoprotein |
| Immunogen: |
Amino acids RRCLRDPQRVLEYCRQMYPELQIARVEQATQ of human APLP1 were used as the immunogen for the APLP1 antibody |
| Storage: |
Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the APLP1 antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term |
| Localization: |
membrane, Cytoplasmic |
| Properties: |
C, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24° |
| Gene target: |
APLP1 |
| Short name: |
APLP1 Antibody |
| Technique: |
antibodies against human proteins, antibodies for, Antibody |
| Alternative name: |
amyloid b (A4) precursor-like protein 1 (Antibody to) |
| Alternative technique: |
antibodies |
| Alternative to gene target: |
APLP, APLP1 and IDBG-45875 and ENSG00000105290 and 333, Aplp1 and IDBG-168935 and ENSMUSG00000006651 and 11803, BT, Plasma membranes, this GO :0005515 and protein binding and molecular function this GO :0005604 and basement membrane and cellular component this GO :0005794 and this GO lgi apparatus and cellular component this GO :0005886 and plasma membrane and cellular component this GO :0006378 and mRNA polyadenylation and biological process this GO :0006417 and regulation of translation and biological process this GO :0006897 and endocytosis and biological process this GO :0006915 and apoptotic process and biological process this GO :0007155 and cell adhesion and biological process this GO :0007193 and adenylate cyclase-inhibiting G-protein coupled receptor signaling pathway and biological process this GO :0007399 and nervous system development and biological process this GO :0008201 and heparin binding and molecular function this GO :0009887 and organ morphogenesis and biological process this GO :0016020 and membrane and cellular component this GO :0016021 and integral component of membrane and cellular component this GO :0030198 and extracellular matrix organization and biological process this GO :0030818 and negative regulation of cAMP biosynthetic process and biological process this GO :0030900 and forebrain development and biological process this GO :0031694 and alpha-2A adrenergic receptor binding and molecular function this GO :0031695 and alpha-2B adrenergic receptor binding and molecular function this GO :0031696 and alpha-2C adrenergic receptor binding and molecular function this GO :0042802 and identical protein binding and molecular function this GO :0046914 and transition metal ion binding and molecular function this GO :0048471 and perinuclear region of cytoplasm and cellular component this GO :0071874 and cellular response to norepinephrine stimulus and biological process, this GO :0005515 : protein binding, this GO :0005515 : protein binding and also this GO :0008201 : heparin binding and also this GO :0031694 : alpha-2A adrenergic receptor binding and also this GO :0031695 : alpha-2B adrenergic receptor binding and also this GO :0031696 : alpha-2C adrenergic receptor binding and also this GO :0042802 : identical protein binding and also this GO :0046914 : transition metal ion binding, this GO :0008201 : heparin binding, this GO :0031694 : alpha-2A adrenergic receptor binding, this GO :0031695 : alpha-2B adrenergic receptor binding, this GO :0031696 : alpha-2C adrenergic receptor binding, this GO :0042802 : identical protein binding, this GO :0046914 : transition metal ion binding, transition metal ion binding, 56047 and IDBG-636032 and ENSBTAG00000001151 and 513154, amyloid beta (A4) precursor-like protein 1 |
| Identity: |
597 |
| Gene: |
APLP1 |
More about : APLP1 |
| Long gene name: |
amyloid beta precursor like protein 1 |
| Synonyms gene name: |
amyloid beta (A4) precursor-like protein 1 |
| Synonyms: |
APLP |
| Synonyms name: |
amyloid-like protein 1 amyloid precursor-like protein 1 |
| Locus: |
19q13, 12 |
| Discovery year: |
1992-06-18 |
| GenBank acession: |
U48437 |
| Entrez gene record: |
333 |
| Pubmed identfication: |
8432545 |
| RefSeq identity: |
NM_001024807 |
| Havana BLAST/BLAT: |
OTTHUMG00000180692 |