| Category: |
Antibody |
| Concentration: |
2ml sterile DI water, 5mg/ml if reconstituted with 0 |
| Form: |
Antigen affinity purified |
| Conjugation: |
Unconjugated |
| Clone: |
Polyclonal antibody |
| Recognised antigen: |
RAB13 |
| Host animal: |
Rabbit (Oryctolagus cuniculus) |
| Clonality: |
Polyclonal (rabbit origin) |
| Species reactivity: |
Due to limited knowledge and inability to test the antibody against all known species, Mouse (Mus musculus), Rat , we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens) |
| Tested applications: |
IHC-P, WB |
| Recommended dilutions: |
1-0, 5-1ug/ml, 5ug/ml, IHC (Paraffin): 0, Western blot: 0 |
| Notes: |
Optimal dilution of the RAB13 antibody should be determined by the researcher |
| Intented use: |
This RAB13 antibodyis to be used only for research purposes and not for diagnostics |
| Uniprot #: |
P51153 |
| Purity: |
Antigen affinity |
| Description: |
A pseudogene associated with this gene is located on chromosome 12, Additional functions associated with the protein include endocytic recycling of occludin, Alternately spliced transcript variants have been observed for this gene, The AJC plays a role in forming a barrier between luminal contents and the underlying tissue, The encoded protein is involved in the assembly of tight junctions, This gene is a member of the Rab family of small G proteins and plays a role in regulating membrane trafficking between trans-Golgi network (TGN) and recycling endosomes (RE), neuronal regeneration and regulation of neurite outgrowth, regulation of epithelial cell scattering, which are components of the apical junctional complex (AJC) of epithelial cells, Ras-related protein Rab-13 is a protein that in humans is encoded by the RAB13 gene |
| Immunogen: |
Amino acids NKCDMEAKRKVQKEQADKLAREHGIRFFET of human RAB13 were used as the immunogen for the RAB13 antibody |
| Storage: |
Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the RAB13 antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term |
| Localization: |
membrane, Cytoplasmic |
| Properties: |
C, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24° |
| Gene target: |
RAB13 |
| Short name: |
RAB13 Antibody |
| Technique: |
antibodies against human proteins, antibodies for, Antibody |
| Alternative name: |
member RAS oncogene family (Antibody to), RAB13 |
| Alternative technique: |
antibodies |
| Alternative to gene target: |
RAB13 and IDBG-102843 and ENSG00000143545 and 5872, RAB13 and IDBG-632584 and ENSBTAG00000017604 and 514541, Rab13 and IDBG-166105 and ENSMUSG00000027935 and 68328, member RAS oncogene family, nuclei, protein kinase A catalytic subunit binding, this GO :0003924 and GTPase activity and molecular function this GO :0005515 and protein binding and molecular function this GO :0005525 and GTP binding and molecular function this GO :0005622 and intracellular and cellular component this GO :0005634 and nucleus and cellular component this GO :0005737 and cytoplasm and cellular component this GO :0005794 and this GO lgi apparatus and cellular component this GO :0005802 and trans- this GO lgi network and cellular component this GO :0005886 and plasma membrane and cellular component this GO :0005911 and cell-cell junction and cellular component this GO :0005923 and tight junction and cellular component this GO :0006184 and GTP catabolic process and biological process this GO :0006886 and intracellular protein transport and biological process this GO :0006913 and nucleocytoplasmic transport and biological process this GO :0007165 and signal transduction and biological process this GO :0007264 and small GTPase mediated signal transduction and biological process this GO :0010737 and protein kinase A signaling and biological process this GO :0015031 and protein transport and biological process this GO :0016020 and membrane and cellular component this GO :0016197 and endosomal transport and biological process this GO :0016328 and lateral plasma membrane and cellular component this GO :0030027 and lamellipodium and cellular component this GO :0030139 and endocytic vesicle and cellular component this GO :0030658 and transport vesicle membrane and cellular component this GO :0030659 and cytoplasmic vesicle membrane and cellular component this GO :0030866 and cortical actin cytoskeleton organization and biological process this GO :0031175 and neuron projection development and biological process this GO :0031410 and cytoplasmic vesicle and cellular component this GO :0032456 and endocytic recycling and biological process this GO :0032593 and insulin-responsive compartment and cellular component this GO :0032869 and cellular response to insulin stimulus and biological process this GO :0034236 and protein kinase A catalytic subunit binding and molecular function this GO :0035767 and endothelial cell chemotaxis and biological process this GO :0043005 and neuron projection and cellular component this GO :0044795 and trans- this GO lgi network to recycling endosome transport and biological process this GO :0055037 and recycling endosome and cellular component this GO :0055038 and recycling endosome membrane and cellular component this GO :0061024 and membrane organization and biological process this GO :0070062 and extracellular vesicular exosome and cellular component this GO :0070830 and tight junction assembly and biological process this GO :0072659 and protein localization to plasma membrane and biological process this GO :0090002 and establishment of protein localization to plasma membrane and biological process this GO :0097368 and establishment of Sertoli cell barrier and biological process this GO :1902463 and protein localization to cell leading edge and biological process, this GO :0003924 : GTPase activity, this GO :0003924 : GTPase activity and also this GO :0005515 : protein binding and also this GO :0005525 : GTP binding and also this GO :0034236 : protein kinase A catalytic subunit binding, this GO :0005515 : protein binding, this GO :0005525 : GTP binding, this GO :0034236 : protein kinase A catalytic subunit binding, RAB13 |
| Identity: |
9762 |
| Gene: |
RAB13 |
More about : RAB13 |
| Long gene name: |
RAB13, member RAS oncogene family |
| Locus: |
1q21, 3 |
| Discovery year: |
1998-01-21 |
| GenBank acession: |
X75593 |
| Entrez gene record: |
5872 |
| Pubmed identfication: |
8294494 |
| RefSeq identity: |
NM_002870 |
| Classification: |
RAB, member RAS oncogene GTPases |
| Havana BLAST/BLAT: |
OTTHUMG00000036589 |