| Category: |
Antibody |
| Concentration: |
2ml sterile DI water, 5mg/ml if reconstituted with 0 |
| Form: |
Antigen affinity purified |
| Conjugation: |
Unconjugated |
| Clone: |
Polyclonal antibody |
| Recognised antigen: |
GNAQ |
| Host animal: |
Rabbit (Oryctolagus cuniculus) |
| Clonality: |
Polyclonal (rabbit origin) |
| Species reactivity: |
Due to limited knowledge and inability to test the antibody against all known species, Mouse (Mus musculus), Rat , we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens) |
| Tested applications: |
IHC-P, WB |
| Recommended dilutions: |
1-0, 5-1ug/ml, 5ug/ml, IHC (Paraffin): 0, Western blot: 0 |
| Notes: |
Optimal dilution of the GNAQ antibody should be determined by the researcher |
| Intented use: |
This GNAQ antibodyis to be used only for research purposes and not for diagnostics |
| Uniprot #: |
P50148 |
| Purity: |
Antigen affinity |
| Description: |
7-transmembrane domain receptors to intracellular signaling pathways, Activation is terminated by a GTPase intrinsic to the G-alpha subunit, G-alpha-q is the alpha subunit of one of the heterotrimeric GTP-binding proteins that mediates stimulation of phospholipase C-beta, Guanine nucleotide-binding proteins are a family of heterotrimeric proteins that couple cell surface, Mutations in this gene have been found associated to cases of Sturge-Weber syndrome and port-wine stains, Receptor activation catalyzes the exchange of GDP for GTP bound to the inactive G protein alpha subunit resulting in a conformational change and dissociation of the complex, The G protein alpha and beta-gamma subunits are capable of regulating various cellular effectors, Guanine nucleotide-binding protein G(q) subunit alpha is a protein that in humans is encoded by the GNAQ gene |
| Immunogen: |
Amino acids KYEHNKAHAQLVREVDVEKVSAFENPYVDAIKSLWND of human GNAQ were used as the immunogen for the GNAQ antibody |
| Storage: |
Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the GNAQ antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term |
| Localization: |
membrane, Cytoplasmic |
| Properties: |
C, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24° |
| Gene target: |
GNAQ |
| Short name: |
GNAQ Antibody |
| Technique: |
antibodies against human proteins, antibodies for, Antibody |
| Alternative name: |
GNAQ (Antibody to) |
| Alternative technique: |
antibodies |
| Identity: |
4390 |
| Gene: |
GNAQ |
More about : GNAQ |
| Long gene name: |
G protein subunit alpha q |
| Synonyms gene name: |
guanine nucleotide binding protein (G protein), q polypeptide |
| Synonyms: |
G-ALPHA-q GAQ |
| Locus: |
9q21, 2 |
| Discovery year: |
1992-12-15 |
| Entrez gene record: |
2776 |
| Pubmed identfication: |
8825633 |
| RefSeq identity: |
NM_002072 |
| Havana BLAST/BLAT: |
OTTHUMG00000020059 |
| Locus Specific Databases: |
LRG_1110 |