GNAQ Antibody

Contact us
Catalog number: R32120
Price: 402 €
Supplier: abebio
Product name: GNAQ Antibody
Quantity: 1x plate of 48 wells
Other quantities: 0.1mg 406€ 0.1ml 263€ 1 vial 521€
Related search:

More details :

Category: Antibody
Concentration: 2ml sterile DI water, 5mg/ml if reconstituted with 0
Form: Antigen affinity purified
Conjugation: Unconjugated
Clone: Polyclonal antibody
Recognised antigen: GNAQ
Host animal: Rabbit (Oryctolagus cuniculus)
Clonality: Polyclonal (rabbit origin)
Species reactivity: Due to limited knowledge and inability to test the antibody against all known species, Mouse (Mus musculus), Rat , we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens)
Tested applications: IHC-P, WB
Recommended dilutions: 1-0, 5-1ug/ml, 5ug/ml, IHC (Paraffin): 0, Western blot: 0
Notes: Optimal dilution of the GNAQ antibody should be determined by the researcher
Intented use: This GNAQ antibodyis to be used only for research purposes and not for diagnostics
Uniprot #: P50148
Purity: Antigen affinity
Description: 7-transmembrane domain receptors to intracellular signaling pathways, Activation is terminated by a GTPase intrinsic to the G-alpha subunit, G-alpha-q is the alpha subunit of one of the heterotrimeric GTP-binding proteins that mediates stimulation of phospholipase C-beta, Guanine nucleotide-binding proteins are a family of heterotrimeric proteins that couple cell surface, Mutations in this gene have been found associated to cases of Sturge-Weber syndrome and port-wine stains, Receptor activation catalyzes the exchange of GDP for GTP bound to the inactive G protein alpha subunit resulting in a conformational change and dissociation of the complex, The G protein alpha and beta-gamma subunits are capable of regulating various cellular effectors, Guanine nucleotide-binding protein G(q) subunit alpha is a protein that in humans is encoded by the GNAQ gene
Immunogen: Amino acids KYEHNKAHAQLVREVDVEKVSAFENPYVDAIKSLWND of human GNAQ were used as the immunogen for the GNAQ antibody
Storage: Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the GNAQ antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term
Localization: membrane, Cytoplasmic
Properties: C, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24°
Gene target: GNAQ
Short name: GNAQ Antibody
Technique: antibodies against human proteins, antibodies for, Antibody
Alternative name: GNAQ (Antibody to)
Alternative technique: antibodies
Identity: 4390
Gene: GNAQ | More about : GNAQ
Long gene name: G protein subunit alpha q
Synonyms gene name: guanine nucleotide binding protein (G protein), q polypeptide
Synonyms: G-ALPHA-q GAQ
Locus: 9q21, 2
Discovery year: 1992-12-15
Entrez gene record: 2776
Pubmed identfication: 8825633
RefSeq identity: NM_002072
Havana BLAST/BLAT: OTTHUMG00000020059
Locus Specific Databases: LRG_1110

Related Products :

AR51618PU-N anti-G protein alpha Q / GNAQ (1-359, His-tag) Antibody 0,5 mg 1109 € acr human
AR51618PU-S anti-G protein alpha Q / GNAQ (1-359, His-tag) Antibody 0,1 mg 485 € acr human
GENTAUR-58bdef038b1e5 Anti- GNAQ Antibody 0.06 ml 265 € MBS Polyclonals human
GENTAUR-58bdef0404d07 Anti- GNAQ Antibody 0.12 ml 348 € MBS Polyclonals human
MBS248089 Anti-Human GNAQ Antibody 50ug 597 € MBS Polyclonals_1 human
GWB-MT476H GNAQ antibody 1 vial 521 € genways human
GWB-MT477I Gnaq antibody 1 vial 521 € genways human
R32120 GNAQ Antibody 0.1mg 406 € NJS poly human
R34779-100UG GNAQ Antibody 0.1mg 406 € NJS poly human
bs-6152R-A350 GNAQ Antibody, ALEXA FLUOR 350 100ul 332 € Bioss Primary Conjugated Antibodies. human
bs-6152R-A488 GNAQ Antibody, ALEXA FLUOR 488 100ul 332 € Bioss Primary Conjugated Antibodies. human
bs-6152R-A555 GNAQ Antibody, ALEXA FLUOR 555 100ul 332 € Bioss Primary Conjugated Antibodies. human
bs-6152R-A594 GNAQ Antibody, ALEXA FLUOR 594 100ul 332 € Bioss Primary Conjugated Antibodies. human
bs-6152R-A647 GNAQ Antibody, ALEXA FLUOR 647 100ul 332 € Bioss Primary Conjugated Antibodies. human
bs-6152R-Biotin GNAQ Antibody, Biotin Conjugated 0.1ml 333 € Bioss Primary Conjugated Antibodies human
bs-6152R GNAQ Antibody 0.1ml 263 € Bioss Primary Unconjugated Antibodies human
bs-6152R-Cy3 GNAQ Antibody, Cy3 Conjugated 0.1ml 350 € Bioss Primary Conjugated Antibodies human
bs-6152R-Cy5 GNAQ Antibody, Cy5 Conjugated 0.1ml 350 € Bioss Primary Conjugated Antibodies human
bs-6152R-Cy5.5 GNAQ Antibody, Cy5.5 Conjugated 0.1ml 350 € Bioss Primary Conjugated Antibodies human
bs-6152R-Cy7 GNAQ Antibody, Cy7 Conjugated 0.1ml 350 € Bioss Primary Conjugated Antibodies human
bs-6152R-FITC GNAQ Antibody, FITC Conjugated 0.1ml 333 € Bioss Primary Conjugated Antibodies human
bs-6152R-HRP GNAQ Antibody, HRP Conjugated 0.1ml 350 € Bioss Primary Conjugated Antibodies human
MBS422578 Goat anti-GNAQ / ALPHA-q (aa162-175) Antibody 100ug 370 € MBS Polyclonals_1 human
MBS243948 Goat Polyclonal to Human GNAQ Antibody 50ug 597 € MBS Polyclonals_1 human
MBS248287 PAb (IgG) to Human GNAQ Antibody 0.05 ml 597 € MBS Polyclonals_1 human
GENTAUR-58be644a7c548 Anti-GNAQ (Polyclonal), ALEXA Fluor 594 100 microliters 489 € Bioss Polyclonal Antibodies human
abx902216 Anti-GNAQ siRNA 15 nmol 528 € abbex human
abx918152 Anti-GNAQ siRNA inquire 50 € abbex human
abx918153 Anti-GNAQ siRNA 30 nmol 717 € abbex human
AE41783PI-48 ELISA test for Pig Guanine nucleotide-binding protein G (GNAQ) 1x plate of 48 wells 402 € abebio pig