| Category: |
Antibody |
| Concentration: |
2ml sterile DI water, 5mg/ml if reconstituted with 0 |
| Form: |
Antigen affinity purified |
| Conjugation: |
Unconjugated |
| Clone: |
Polyclonal antibody |
| Recognised antigen: |
Phospholipase A2 / PLA2G4A / CPLA2 |
| Host animal: |
Rabbit (Oryctolagus cuniculus) |
| Clonality: |
Polyclonal (rabbit origin) |
| Species reactivity: |
Due to limited knowledge and inability to test the antibody against all known species, Mouse (Mus musculus) , we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens) |
| Tested applications: |
WB |
| Recommended dilutions: |
1-0, 5ug/ml, Western blot: 0 |
| Notes: |
Optimal dilution of the Phospholipase A2 antibody should be determined by the researcher |
| Intented use: |
This Phospholipase A2 antibodyis to be used only for research purposes and not for diagnostics |
| Uniprot #: |
P47712 |
| Purity: |
Antigen affinity |
| Description: |
(1994) determined that ser228 participates in the catalytic mechanism of cPLA2 and that both the phospholipase A2 and the lysophospholipase activities are catalyzed by the same active site residue(s), (1995) mapped the PLA2G4A gene to rat chromosome 13 by PCR-based intercross genotyping and to human 1q25 by fluorescence in situ hybridization, 1995), By site-directed mutagenesis and biochemical analysis of the recombinant protein, Group IVA, PLA2G4A, Sharp et al, Tay et al, appears to subserve transmembrane signaling responses to extracellular ligands (Skorecki, is an enzyme that in humans is encoded by the PLA2G4A gene, the cytosolic phospholipase A2, Phospholipase A2 |
| Immunogen: |
Amino acids NFQYPNQAFKRLHDLMHFNTLNNIDVIKEAMVESIEYRRQ of human PLA2G4A were used as the immunogen for the Phospholipase A2 antibody |
| Storage: |
Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the Phospholipase A2 antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term |
| Properties: |
C, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24° |
| Gene target: |
Phospholipase A2 / PLA2G4A / CPLA2 |
| Short name: |
Phospholipase A2 Antibody / PLA2G4A / CPLA2 |
| Technique: |
antibodies against human proteins, antibodies for, Antibody |
| Alternative name: |
calcium-dependent) / CPLA2, family IVA (cytosolic, Phospholipase A2 (Antibody to) / phospholipase A2 |
| Alternative technique: |
antibodies |
| Alternative to gene target: |
Cytoplasm, PLA2G4A and IDBG-105429 and ENSG00000116711 and 5321, PLA2G4A and IDBG-637785 and ENSBTAG00000013298 and 525072, Pla2g4a and IDBG-197265 and ENSMUSG00000056220 and 18783, cPLA2-alpha and PLA2G4, calcium-dependent phospholipase A2 activity, calcium-dependent), group IVA (cytosolic, this GO :0004620 and phospholipase activity and molecular function this GO :0004622 and lysophospholipase activity and molecular function this GO :0004623 and phospholipase A2 activity and molecular function this GO :0005509 and calcium ion binding and molecular function this GO :0005515 and protein binding and molecular function this GO :0005544 and calcium-dependent phospholipid binding and molecular function this GO :0005737 and cytoplasm and cellular component this GO :0005743 and mitochondrial inner membrane and cellular component this GO :0005783 and endoplasmic reticulum and cellular component this GO :0005789 and endoplasmic reticulum membrane and cellular component this GO :0005794 and this GO lgi apparatus and cellular component this GO :0005829 and cytosol and cellular component this GO :0006644 and phospholipid metabolic process and biological process this GO :0006654 and phosphatidic acid biosynthetic process and biological process this GO :0006663 and platelet activating factor biosynthetic process and biological process this GO :0006690 and icosanoid metabolic process and biological process this GO :0007596 and blood coagulation and biological process this GO :0008152 and metabolic process and biological process this GO :0009395 and phospholipid catabolic process and biological process this GO :0016023 and cytoplasmic membrane-bounded vesicle and cellular component this GO :0019369 and arachidonic acid metabolic process and biological process this GO :0030168 and platelet activation and biological process this GO :0035965 and cardiolipin acyl-chain remodeling and biological process this GO :0036148 and phosphatidylglycerol acyl-chain remodeling and biological process this GO :0036149 and phosphatidylinositol acyl-chain remodeling and biological process this GO :0036150 and phosphatidylserine acyl-chain remodeling and biological process this GO :0036151 and phosphatidylcholine acyl-chain remodeling and biological process this GO :0036152 and phosphatidylethanolamine acyl-chain remodeling and biological process this GO :0042127 and regulation of cell proliferation and biological process this GO :0044281 and small molecule metabolic process and biological process this GO :0045087 and innate immune response and biological process this GO :0046456 and icosanoid biosynthetic process and biological process this GO :0046474 and glycerophospholipid biosynthetic process and biological process this GO :0047498 and calcium-dependent phospholipase A2 activity and molecular function this GO :0050482 and arachidonic acid secretion and biological process this GO :0071236 and cellular response to antibiotic and biological process, this GO :0004620 : phospholipase activity, this GO :0004620 : phospholipase activity and also this GO :0004622 : lysophospholipase activity and also this GO :0004623 : phospholipase A2 activity and also this GO :0005509 : calcium ion binding and also this GO :0005515 : protein binding and also this GO :0005544 : calcium-dependent phospholipid binding and also this GO :0047498 : calcium-dependent phospholipase A2 activity, this GO :0004622 : lysophospholipase activity, this GO :0004623 : phospholipase A2 activity, this GO :0005509 : calcium ion binding, this GO :0005515 : protein binding, this GO :0005544 : calcium-dependent phospholipid binding, this GO :0047498 : calcium-dependent phospholipase A2 activity, phospholipase A2 |
| Identity: |
9035 |
| Gene: |
PLA2G4A |
More about : PLA2G4A |
| Long gene name: |
phospholipase A2 group IVA |
| Synonyms gene: |
PLA2G4 |
| Synonyms gene name: |
calcium-dependent) , group IVA (cytosolic, phospholipase A2 |
| Synonyms: |
cPLA2-alpha |
| Locus: |
1q31, 1 |
| Discovery year: |
1994-11-30 |
| GenBank acession: |
M72393 |
| Entrez gene record: |
5321 |
| Pubmed identfication: |
8175726 |
| RefSeq identity: |
NM_024420 |
| Classification: |
Phospholipases C2 domain containing phospholipases |
| Havana BLAST/BLAT: |
OTTHUMG00000035512 |
| Locus Specific Databases: |
LRG_596 |