LIF Receptor Antibody / LIFR

Contact us
Catalog number: R32098
Price: 553 €
Supplier: MBS Polyclonals
Product name: LIF Receptor Antibody / LIFR
Quantity: 100ug
Related search:

More details :

Category: Antibody
Concentration: 2ml sterile DI water, 5mg/ml if reconstituted with 0
Form: Antigen affinity purified
Conjugation: Unconjugated
Clone: Polyclonal antibody
Recognised antigen: LIF Receptor / LIFR
Host animal: Rabbit (Oryctolagus cuniculus)
Clonality: Polyclonal (rabbit origin)
Species reactivity: Due to limited knowledge and inability to test the antibody against all known species, we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens)
Tested applications: WB
Recommended dilutions: 1-0, 5ug/ml, Western blot: 0
Notes: Optimal dilution of the LIFR antibody should be determined by the researcher
Intented use: This LIFR antibodyis to be used only for research purposes and not for diagnostics
Uniprot #: P42702
Purity: Antigen affinity
Description: A translocation that involves the promoter of this gene, Multiple splice variants encoding the same protein have been found for this gene, Mutations in this gene cause Schwartz-Jampel syndrome type 2, This gene encodes a protein that belongs to the type I cytokine receptor family, This protein combines with a high-affinity converter subunit, a common type of benign epithelial tumor of the salivary gland, a disease belonging to the group of the bent-bone dysplasias, a polyfunctional cytokine that is involved in cellular differentiation, gp130, is a subunit of a receptor for leukemia inhibitory factor, is associated with salivary gland pleiomorphic adenoma, proliferation and survival in the adult and the embryo, t(5, to form a receptor complex that mediates the action of the leukemia inhibitory factor, 8)(p13, LIFR also known as CD118 (Cluster of Differentiation 118), q12) with the pleiomorphic adenoma gene 1
Immunogen: Amino acids EWIKETFYPDIPNPENCKALQFQKSVCEGSSALKTLE of human LIFR were used as the immunogen for the LIFR antibody
Storage: Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the LIFR antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term
Properties: C, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24°
Gene target: LIF Receptor / LIFR
Short name: LIF Receptor Antibody / LIFR
Technique: antibodies against human proteins, antibodies for, Antibody
Alternative name: leukemia inhibitory factor Receptor (Antibody to) / leukemia inhibitory factor receptor alpha
Alternative technique: antibodies
Alternative to gene target: CD118 and LIF-R and SJS2 and STWS and SWS, CDF and DIA and HILDA and MLPLI, Extracellular, Extracellular, LIF and IDBG-3968 and ENSG00000128342 and 3976, LIF and IDBG-636335 and ENSBTAG00000007424 and 280840, LIFR and IDBG-17489 and ENSG00000113594 and 3977, LIFR and IDBG-630017 and ENSBTAG00000010423 and 539504, Lif and IDBG-142317 and ENSMUSG00000034394 and 16878, Lifr and IDBG-128297 and ENSMUSG00000054263 and 16880, growth factor activity, growth factor binding, leukemia inhibitory factor receptor alpha, this GO :0001135 and RNA polymerase II transcription factor recruiting transcription factor activity and molecular function this GO :0001974 and blood vessel remodeling and biological process this GO :0005102 and receptor binding and molecular function this GO :0005125 and cytokine activity and molecular function this GO :0005146 and leukemia inhibitory factor receptor binding and molecular function this GO :0005576 and extracellular region and cellular component this GO :0005615 and extracellular space and cellular component this GO :0005737 and cytoplasm and cellular component this GO :0006366 and transcription from RNA polymerase II promoter and biological process this GO :0006955 and immune response and biological process this GO :0007275 and multicellular organismal development and biological process this GO :0007566 and embryo implantation and biological process this GO :0008083 and growth factor activity and molecular function this GO :0008284 and positive regulation of cell proliferation and biological process this GO :0008285 and negative regulation of cell proliferation and biological process this GO :0019827 and stem cell maintenance and biological process this GO :0030324 and lung development and biological process this GO :0033138 and positive regulation of peptidyl-serine phosphorylation and biological process this GO :0033141 and positive regulation of peptidyl-serine phosphorylation of STAT protein and biological process this GO :0042503 and tyrosine phosphorylation of Stat3 protein and biological process this GO :0042511 and positive regulation of tyrosine phosphorylation of Stat1 protein and biological process this GO :0042517 and positive regulation of tyrosine phosphorylation of Stat3 protein and biological process this GO :0043410 and positive regulation of MAPK cascade and biological process this GO :0045595 and regulation of cell differentiation and biological process this GO :0045651 and positive regulation of macrophage differentiation and biological process this GO :0045835 and negative regulation of meiosis and biological process this GO :0045944 and positive regulation of transcription from RNA polymerase II promoter and biological process this GO :0046697 and decidualization and biological process this GO :0046888 and negative regulation of hormone secretion and biological process this GO :0048286 and lung alveolus development and biological process this GO :0048644 and muscle organ morphogenesis and biological process this GO :0048666 and neuron development and biological process this GO :0048711 and positive regulation of astrocyte differentiation and biological process this GO :0048861 and leukemia inhibitory factor signaling pathway and biological process this GO :0048863 and stem cell differentiation and biological process this GO :0050731 and positive regulation of peptidyl-tyrosine phosphorylation and biological process this GO :0060135 and maternal process involved in female pregnancy and biological process this GO :0060426 and lung vasculature development and biological process this GO :0060463 and lung lobe morphogenesis and biological process this GO :0060707 and trophoblast giant cell differentiation and biological process this GO :0060708 and spongiotrophoblast differentiation and biological process this GO :0070373 and negative regulation of ERK1 and ERK2 cascade and biological process this GO :0072108 and positive regulation of mesenchymal to epithelial transition involved in metanephros morphogenesis and biological process this GO :0072307 and regulation of metanephric nephron tubule epithelial cell differentiation and biological process this GO :1900182 and positive regulation of protein localization to nucleus and biological process this GO :1901676 and positive regulation of histone H3-K27 acetylation and biological process, this GO :0001135 : RNA polymerase II transcription factor recruiting transcription factor activity, this GO :0001135 : RNA polymerase II transcription factor recruiting transcription factor activity and also this GO :0005102 : receptor binding and also this GO :0005125 : cytokine activity and also this GO :0005146 : leukemia inhibitory factor receptor binding and also this GO :0008083 : growth factor activity, this GO :0004897 and ciliary neurotrophic factor receptor activity and molecular function this GO :0004923 and leukemia inhibitory factor receptor activity and molecular function this GO :0004924 and oncostatin-M receptor activity and molecular function this GO :0005127 and ciliary neurotrophic factor receptor binding and molecular function this GO :0005515 and protein binding and molecular function this GO :0005576 and extracellular region and cellular component this GO :0005887 and integral component of plasma membrane and cellular component this GO :0007166 and cell surface receptor signaling pathway and biological process this GO :0008284 and positive regulation of cell proliferation and biological process this GO :0019221 and cytokine-mediated signaling pathway and biological process this GO :0019838 and growth factor binding and molecular function this GO :0034097 and response to cytokine and biological process this GO :0038165 and oncostatin-M-mediated signaling pathway and biological process this GO :0048861 and leukemia inhibitory factor signaling pathway and biological process this GO :0070120 and ciliary neurotrophic factor-mediated signaling pathway and biological process, this GO :0004897 : ciliary neurotrophic factor receptor activity, this GO :0004897 : ciliary neurotrophic factor receptor activity and also this GO :0004923 : leukemia inhibitory factor receptor activity and also this GO :0004924 : oncostatin-M receptor activity and also this GO :0005127 : ciliary neurotrophic factor receptor binding and also this GO :0005515 : protein binding and also this GO :0019838 : growth factor binding, this GO :0004923 : leukemia inhibitory factor receptor activity, this GO :0004924 : oncostatin-M receptor activity, this GO :0005102 : receptor binding, this GO :0005125 : cytokine activity, this GO :0005127 : ciliary neurotrophic factor receptor binding, this GO :0005146 : leukemia inhibitory factor receptor binding, this GO :0005515 : protein binding, this GO :0008083 : growth factor activity, this GO :0019838 : growth factor binding, leukemia inhibitory factor
Identity: 6597
Gene: LIFR | More about : LIFR
Long gene name: leukemia inhibitory factor receptor alpha
Synonyms gene name: leukemia inhibitory factor receptor
Synonyms: CD118
Locus: 5p13, 1
Discovery year: 1992-08-24
GenBank acession: X61615
Entrez gene record: 3977
Pubmed identfication: 1915266
RefSeq identity: NM_002310
Classification: CD molecules Fibronectin type III domain containing
Havana BLAST/BLAT: OTTHUMG00000131138

Related Products :

R32098 LIF Receptor Antibody / LIFR 0.1mg 406 € NJS poly human
MBS619539 Orexin 1 Receptor (Orexin Receptor 1, Orexin Receptor-1, Orexin Receptor Type 1, OX1R, Hypocretin 1 Receptor, Hypocretin Receptor 1, Hypocretin Receptor-1, Hypocretin Receptor Type 1, HCRTR1) 100ug 735 € MBS Polyclonals_1 human
GENTAUR-58bdc3979fa7b Anti- Leukemia Inhibitory Factor Receptor (LIFR) Antibody 50ug 359 € MBS Polyclonals human
GENTAUR-58bdc39806b58 Anti- Leukemia Inhibitory Factor Receptor (LIFR) Antibody 100ug 459 € MBS Polyclonals human
GENTAUR-58bdc3a8a0006 Anti- Leukemia Inhibitory Factor Receptor (LIFR) Antibody 50ug 370 € MBS Polyclonals human
GENTAUR-58bdc3a90d8fe Anti- Leukemia Inhibitory Factor Receptor (LIFR) Antibody 100ug 481 € MBS Polyclonals human
GENTAUR-58bdc3f9a094b Anti- Leukemia Inhibitory Factor Receptor (LIFR) Antibody 100ug 486 € MBS Polyclonals human
GENTAUR-58bdc4882bc55 Anti- Leukemia Inhibitory Factor Receptor (LIFR) Antibody 100ug 481 € MBS Polyclonals human
GENTAUR-58bdc488a34b4 Anti- Leukemia Inhibitory Factor Receptor (LIFR) Antibody 50ug 370 € MBS Polyclonals human
GENTAUR-58bdc56e7726b Anti- Leukemia Inhibitory Factor Receptor (LIFR) Antibody 100ug 453 € MBS Polyclonals human
GENTAUR-58bdc56ebf4c7 Anti- Leukemia Inhibitory Factor Receptor (LIFR) Antibody 50ug 354 € MBS Polyclonals human
GENTAUR-58bdc89de9d8c Anti- Leukemia Inhibitory Factor Receptor (LIFR) Antibody 100ug 481 € MBS Polyclonals human
GENTAUR-58bdc89e480e0 Anti- Leukemia Inhibitory Factor Receptor (LIFR) Antibody 50ug 370 € MBS Polyclonals human
GENTAUR-58bdc9ff1ec8d Anti- Leukemia Inhibitory Factor Receptor (LIFR) Antibody 100ug 564 € MBS Polyclonals human
GENTAUR-58bdcb2061103 Anti- Leukemia Inhibitory Factor Receptor (LIFR) Antibody 50ug 354 € MBS Polyclonals human
GENTAUR-58bdcb20d4653 Anti- Leukemia Inhibitory Factor Receptor (LIFR) Antibody 100ug 453 € MBS Polyclonals human
GENTAUR-58bdcc20b7890 Anti- Leukemia Inhibitory Factor Receptor (LIFR) Antibody 50ug 354 € MBS Polyclonals human
GENTAUR-58bdcc2181dbe Anti- Leukemia Inhibitory Factor Receptor (LIFR) Antibody 100ug 453 € MBS Polyclonals human
GENTAUR-58bdce158bfbd Anti- Leukemia Inhibitory Factor Receptor (LIFR) Antibody 100ug 459 € MBS Polyclonals human
GENTAUR-58bdce15d60eb Anti- Leukemia Inhibitory Factor Receptor (LIFR) Antibody 50ug 359 € MBS Polyclonals human
GENTAUR-58bdce736fbea Anti- Leukemia Inhibitory Factor Receptor (LIFR) Antibody 100ug 459 € MBS Polyclonals human
GENTAUR-58bdce73df52e Anti- Leukemia Inhibitory Factor Receptor (LIFR) Antibody 50ug 359 € MBS Polyclonals human
GENTAUR-58bdd000556c3 Anti- Leukemia Inhibitory Factor Receptor (LIFR) Antibody 100ug 498 € MBS Polyclonals human
GENTAUR-58bdd19c599d9 Anti- Leukemia Inhibitory Factor Receptor (LIFR) Antibody 100ug 520 € MBS Polyclonals human
GENTAUR-58bdd1a105953 Anti- Leukemia Inhibitory Factor Receptor (LIFR) Antibody 100ug 520 € MBS Polyclonals human
GENTAUR-58bdd2a8e954d Anti- Leukemia Inhibitory Factor Receptor (LIFR) Antibody 100ug 498 € MBS Polyclonals human
GENTAUR-58bdd3402893f Anti- Leukemia Inhibitory Factor Receptor (LIFR) Antibody 100ug 486 € MBS Polyclonals human
GENTAUR-58bdd35230201 Anti- Leukemia Inhibitory Factor Receptor (LIFR) Antibody 100ug 498 € MBS Polyclonals human
GENTAUR-58bdd3bb2053b Anti- Leukemia Inhibitory Factor Receptor (LIFR) Antibody 100ug 486 € MBS Polyclonals human
GENTAUR-58bdd3ea4d1c3 Anti- Leukemia Inhibitory Factor Receptor (LIFR) Antibody 100ug 553 € MBS Polyclonals human