| Category: |
Antibody |
| Concentration: |
2ml sterile DI water, 5mg/ml if reconstituted with 0 |
| Form: |
Antigen affinity purified |
| Conjugation: |
Unconjugated |
| Clone: |
Polyclonal antibody |
| Recognised antigen: |
LIF Receptor / LIFR |
| Host animal: |
Rabbit (Oryctolagus cuniculus) |
| Clonality: |
Polyclonal (rabbit origin) |
| Species reactivity: |
Due to limited knowledge and inability to test the antibody against all known species, we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens) |
| Tested applications: |
WB |
| Recommended dilutions: |
1-0, 5ug/ml, Western blot: 0 |
| Notes: |
Optimal dilution of the LIFR antibody should be determined by the researcher |
| Intented use: |
This LIFR antibodyis to be used only for research purposes and not for diagnostics |
| Uniprot #: |
P42702 |
| Purity: |
Antigen affinity |
| Description: |
A translocation that involves the promoter of this gene, Multiple splice variants encoding the same protein have been found for this gene, Mutations in this gene cause Schwartz-Jampel syndrome type 2, This gene encodes a protein that belongs to the type I cytokine receptor family, This protein combines with a high-affinity converter subunit, a common type of benign epithelial tumor of the salivary gland, a disease belonging to the group of the bent-bone dysplasias, a polyfunctional cytokine that is involved in cellular differentiation, gp130, is a subunit of a receptor for leukemia inhibitory factor, is associated with salivary gland pleiomorphic adenoma, proliferation and survival in the adult and the embryo, t(5, to form a receptor complex that mediates the action of the leukemia inhibitory factor, 8)(p13, LIFR also known as CD118 (Cluster of Differentiation 118), q12) with the pleiomorphic adenoma gene 1 |
| Immunogen: |
Amino acids EWIKETFYPDIPNPENCKALQFQKSVCEGSSALKTLE of human LIFR were used as the immunogen for the LIFR antibody |
| Storage: |
Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the LIFR antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term |
| Properties: |
C, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24° |
| Gene target: |
LIF Receptor / LIFR |
| Short name: |
LIF Receptor Antibody / LIFR |
| Technique: |
antibodies against human proteins, antibodies for, Antibody |
| Alternative name: |
leukemia inhibitory factor Receptor (Antibody to) / leukemia inhibitory factor receptor alpha |
| Alternative technique: |
antibodies |
| Alternative to gene target: |
CD118 and LIF-R and SJS2 and STWS and SWS, CDF and DIA and HILDA and MLPLI, Extracellular, Extracellular, LIF and IDBG-3968 and ENSG00000128342 and 3976, LIF and IDBG-636335 and ENSBTAG00000007424 and 280840, LIFR and IDBG-17489 and ENSG00000113594 and 3977, LIFR and IDBG-630017 and ENSBTAG00000010423 and 539504, Lif and IDBG-142317 and ENSMUSG00000034394 and 16878, Lifr and IDBG-128297 and ENSMUSG00000054263 and 16880, growth factor activity, growth factor binding, leukemia inhibitory factor receptor alpha, this GO :0001135 and RNA polymerase II transcription factor recruiting transcription factor activity and molecular function this GO :0001974 and blood vessel remodeling and biological process this GO :0005102 and receptor binding and molecular function this GO :0005125 and cytokine activity and molecular function this GO :0005146 and leukemia inhibitory factor receptor binding and molecular function this GO :0005576 and extracellular region and cellular component this GO :0005615 and extracellular space and cellular component this GO :0005737 and cytoplasm and cellular component this GO :0006366 and transcription from RNA polymerase II promoter and biological process this GO :0006955 and immune response and biological process this GO :0007275 and multicellular organismal development and biological process this GO :0007566 and embryo implantation and biological process this GO :0008083 and growth factor activity and molecular function this GO :0008284 and positive regulation of cell proliferation and biological process this GO :0008285 and negative regulation of cell proliferation and biological process this GO :0019827 and stem cell maintenance and biological process this GO :0030324 and lung development and biological process this GO :0033138 and positive regulation of peptidyl-serine phosphorylation and biological process this GO :0033141 and positive regulation of peptidyl-serine phosphorylation of STAT protein and biological process this GO :0042503 and tyrosine phosphorylation of Stat3 protein and biological process this GO :0042511 and positive regulation of tyrosine phosphorylation of Stat1 protein and biological process this GO :0042517 and positive regulation of tyrosine phosphorylation of Stat3 protein and biological process this GO :0043410 and positive regulation of MAPK cascade and biological process this GO :0045595 and regulation of cell differentiation and biological process this GO :0045651 and positive regulation of macrophage differentiation and biological process this GO :0045835 and negative regulation of meiosis and biological process this GO :0045944 and positive regulation of transcription from RNA polymerase II promoter and biological process this GO :0046697 and decidualization and biological process this GO :0046888 and negative regulation of hormone secretion and biological process this GO :0048286 and lung alveolus development and biological process this GO :0048644 and muscle organ morphogenesis and biological process this GO :0048666 and neuron development and biological process this GO :0048711 and positive regulation of astrocyte differentiation and biological process this GO :0048861 and leukemia inhibitory factor signaling pathway and biological process this GO :0048863 and stem cell differentiation and biological process this GO :0050731 and positive regulation of peptidyl-tyrosine phosphorylation and biological process this GO :0060135 and maternal process involved in female pregnancy and biological process this GO :0060426 and lung vasculature development and biological process this GO :0060463 and lung lobe morphogenesis and biological process this GO :0060707 and trophoblast giant cell differentiation and biological process this GO :0060708 and spongiotrophoblast differentiation and biological process this GO :0070373 and negative regulation of ERK1 and ERK2 cascade and biological process this GO :0072108 and positive regulation of mesenchymal to epithelial transition involved in metanephros morphogenesis and biological process this GO :0072307 and regulation of metanephric nephron tubule epithelial cell differentiation and biological process this GO :1900182 and positive regulation of protein localization to nucleus and biological process this GO :1901676 and positive regulation of histone H3-K27 acetylation and biological process, this GO :0001135 : RNA polymerase II transcription factor recruiting transcription factor activity, this GO :0001135 : RNA polymerase II transcription factor recruiting transcription factor activity and also this GO :0005102 : receptor binding and also this GO :0005125 : cytokine activity and also this GO :0005146 : leukemia inhibitory factor receptor binding and also this GO :0008083 : growth factor activity, this GO :0004897 and ciliary neurotrophic factor receptor activity and molecular function this GO :0004923 and leukemia inhibitory factor receptor activity and molecular function this GO :0004924 and oncostatin-M receptor activity and molecular function this GO :0005127 and ciliary neurotrophic factor receptor binding and molecular function this GO :0005515 and protein binding and molecular function this GO :0005576 and extracellular region and cellular component this GO :0005887 and integral component of plasma membrane and cellular component this GO :0007166 and cell surface receptor signaling pathway and biological process this GO :0008284 and positive regulation of cell proliferation and biological process this GO :0019221 and cytokine-mediated signaling pathway and biological process this GO :0019838 and growth factor binding and molecular function this GO :0034097 and response to cytokine and biological process this GO :0038165 and oncostatin-M-mediated signaling pathway and biological process this GO :0048861 and leukemia inhibitory factor signaling pathway and biological process this GO :0070120 and ciliary neurotrophic factor-mediated signaling pathway and biological process, this GO :0004897 : ciliary neurotrophic factor receptor activity, this GO :0004897 : ciliary neurotrophic factor receptor activity and also this GO :0004923 : leukemia inhibitory factor receptor activity and also this GO :0004924 : oncostatin-M receptor activity and also this GO :0005127 : ciliary neurotrophic factor receptor binding and also this GO :0005515 : protein binding and also this GO :0019838 : growth factor binding, this GO :0004923 : leukemia inhibitory factor receptor activity, this GO :0004924 : oncostatin-M receptor activity, this GO :0005102 : receptor binding, this GO :0005125 : cytokine activity, this GO :0005127 : ciliary neurotrophic factor receptor binding, this GO :0005146 : leukemia inhibitory factor receptor binding, this GO :0005515 : protein binding, this GO :0008083 : growth factor activity, this GO :0019838 : growth factor binding, leukemia inhibitory factor |
| Identity: |
6597 |
| Gene: |
LIFR |
More about : LIFR |
| Long gene name: |
leukemia inhibitory factor receptor alpha |
| Synonyms gene name: |
leukemia inhibitory factor receptor |
| Synonyms: |
CD118 |
| Locus: |
5p13, 1 |
| Discovery year: |
1992-08-24 |
| GenBank acession: |
X61615 |
| Entrez gene record: |
3977 |
| Pubmed identfication: |
1915266 |
| RefSeq identity: |
NM_002310 |
| Classification: |
CD molecules Fibronectin type III domain containing |
| Havana BLAST/BLAT: |
OTTHUMG00000131138 |