AQP2 Antibody / Aquaporin 2

Contact us
Catalog number: R32091
Price: 846 €
Supplier: DL elisas
Product name: AQP2 Antibody / Aquaporin 2
Quantity: 96T
Related search:

More details :

Category: Antibody
Concentration: 2ml sterile DI water, 5mg/ml if reconstituted with 0
Form: Antigen affinity purified
Conjugation: Unconjugated
Clone: Polyclonal antibody
Recognised antigen: AQP2 / Aquaporin 2
Host animal: Rabbit (Oryctolagus cuniculus)
Clonality: Polyclonal (rabbit origin)
Species reactivity: Due to limited knowledge and inability to test the antibody against all known species, Mouse (Mus musculus), Rat , we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens)
Tested applications: IHC-P, WB
Recommended dilutions: 1-0, 5-1ug/ml, 5ug/ml, IHC (Paraffin): 0, Western blot: 0
Notes: Optimal dilution of the Aquaporin 2 antibody should be determined by the researcher
Intented use: This Aquaporin 2 antibodyis to be used only for research purposes and not for diagnostics
Uniprot #: P41181
Purity: Antigen affinity
Description: AQP2 expression in kidney connecting tubules is sufficient for survival and that AQP2 expression in collecting ducts is required to regulate body water balance, AQP2 trafficking can be stimulated by cAMP-independent pathways that utilize nitric oxide (NO), Atrial natriuretic factor, SNP increased intracellular cGMP rather than cAMP, The AQP2 gene is mapped to chromosome 12q13, The NO donors sodium nitroprusside (SNP) and NONOate and the NO synthase substrate L-arginine mimicked the effect of vasopressin (VP), The S256L substitution in the cytoplasmic tail of the Aqp2 protein prevented phosphorylation at S256 and the subsequent accumulation of Aqp2 on the apical membrane of the collecting duct principal cells, The functional expression and the limited localization suggested that AQP2 is the vasopressin-regulated water channel, The investigators suggested that a defect in the AQP2 gene is the basis of the autosomal form of nephrogenic diabetes insipidus, Using rat kidney slices and porcine kidney cells stably expressing rat Aqp2, also called AQUAPORIN-CD, also stimulated AQP2 translocation, and exogenous cGMP stimulated AQP2 membrane insertion, is found in the apical cell membranes of the kidney's collecting duct principal cells and in intracellular vesicles located throughout the cell, stimulating relocation of Aqp2 from cytoplasmic vesicles to the apical plasma membrane, very close to the site of major intrinsic protein by situ hybridization, which signals via cGMP, AQP2 (Aquaporin 2)
Immunogen: Amino acids EPDTDWEEREVRRRQSVELHSPQSLPRGTKA of human Aquaporin 2 were used as the immunogen for the Aquaporin 2 antibody
Storage: Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the Aquaporin 2 antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term
Properties: C, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24°
Gene target: AQP2 / Aquaporin 2
Short name: AQP2 Antibody / Aquaporin 2
Technique: antibodies against human proteins, antibodies for, Antibody
Alternative name: aquaporin 2 (collecting duct) (Antibody to) / Aquaporin 2
Alternative technique: antibodies
Alternative to gene target: AQP-CD and WCH-CD, AQP2 and IDBG-32089 and ENSG00000167580 and 359, AQP2 and IDBG-632459 and ENSBTAG00000008374 and 539870, Aqp2 and IDBG-183373 and ENSMUSG00000023013 and 11827, PDZ domain binding, Plasma membranes, this GO :0003097 and renal water transport and biological process this GO :0003779 and actin binding and molecular function this GO :0005215 and transporter activity and molecular function this GO :0005372 and water transmembrane transporter activity and molecular function this GO :0005515 and protein binding and molecular function this GO :0005737 and cytoplasm and cellular component this GO :0005764 and lysosome and cellular component this GO :0005769 and early endosome and cellular component this GO :0005791 and rough endoplasmic reticulum and cellular component this GO :0005802 and trans- this GO lgi network and cellular component this GO :0005886 and plasma membrane and cellular component this GO :0006810 and transport and biological process this GO :0006833 and water transport and biological process this GO :0006884 and cell volume homeostasis and biological process this GO :0006915 and apoptotic process and biological process this GO :0006972 and hyperosmotic response and biological process this GO :0007565 and female pregnancy and biological process this GO :0007568 and aging and biological process this GO :0007588 and excretion and biological process this GO :0009414 and response to water deprivation and biological process this GO :0009651 and response to salt stress and biological process this GO :0009725 and response to hormone and biological process this GO :0010226 and response to lithium ion and biological process this GO :0015168 and glycerol transmembrane transporter activity and molecular function this GO :0015250 and water channel activity and molecular function this GO :0015793 and glycerol transport and biological process this GO :0016020 and membrane and cellular component this GO :0016021 and integral component of membrane and cellular component this GO :0016323 and basolateral plasma membrane and cellular component this GO :0016324 and apical plasma membrane and cellular component this GO :0030042 and actin filament depolymerization and biological process this GO :0030133 and transport vesicle and cellular component this GO :0030136 and clathrin-coated vesicle and cellular component this GO :0030165 and PDZ domain binding and molecular function this GO :0030658 and transport vesicle membrane and cellular component this GO :0031410 and cytoplasmic vesicle and cellular component this GO :0032496 and response to lipopolysaccharide and biological process this GO :0033762 and response to gluca this GO n and biological process this GO :0042594 and response to starvation and biological process this GO :0042631 and cellular response to water deprivation and biological process this GO :0043234 and protein complex and cellular component this GO :0051592 and response to calcium ion and biological process this GO :0051928 and positive regulation of calcium ion transport and biological process this GO :0055037 and recycling endosome and cellular component this GO :0055085 and transmembrane transport and biological process this GO :0070062 and extracellular vesicular exosome and cellular component this GO :0070382 and exocytic vesicle and cellular component this GO :0071280 and cellular response to copper ion and biological process this GO :0071288 and cellular response to mercury ion and biological process this GO :0072205 and metanephric collecting duct development and biological process, this GO :0003779 : actin binding, this GO :0003779 : actin binding and also this GO :0005215 : transporter activity and also this GO :0005372 : water transmembrane transporter activity and also this GO :0005515 : protein binding and also this GO :0015168 : glycerol transmembrane transporter activity and also this GO :0015250 : water channel activity and also this GO :0030165 : PDZ domain binding, this GO :0005215 : transporter activity, this GO :0005372 : water transmembrane transporter activity, this GO :0005515 : protein binding, this GO :0015168 : glycerol transmembrane transporter activity, this GO :0015250 : water channel activity, this GO :0030165 : PDZ domain binding, aquaporin 2 (collecting duct)
Identity: 634
Gene: AQP2 | More about : AQP2
Long gene name: aquaporin 2
Synonyms gene name: aquaporin 2 (collecting duct)
Locus: 12q13, 12
Discovery year: 1993-07-09
Entrez gene record: 359
Pubmed identfication: 7512890
RefSeq identity: NM_000486
Classification: Aquaporins
Havana BLAST/BLAT: OTTHUMG00000169709
Locus Specific Databases: LRG_717

Related Products :

GWB-37F83B Aquaporin 2 (Collecting Duct) (AQP2) Rabbit antibody to or anti-Human Polyclonal (N- terminus) antibody 1 x 1 vial 602 € genways human
B0768-1 anti-Aquaporin-2 / AQP2 Antibody 50 Вµg 347 € acr human
B0768-2 anti-Aquaporin-2 / AQP2 Antibody 0,1 mg 500 € acr human
BB-PA1742 anti-Aquaporin-2 / AQP2 Antibody 0,1 mg 471 € acr human
AP09888PU-N anti-Aquaporin-2 / AQP2 (C-term amidated) Antibody 0,1 mg 659 € acr human
AP09888CP-N anti-Aquaporin-2 / AQP2 control peptide Antibody 0,25 mg 413 € acr human
AP08304PU-N anti-Aquaporin-2 / AQP2 (N-term) Antibody 50 Вµg 732 € acr human
AP05670PU-N anti-Aquaporin-2 / AQP2 pSer261 Antibody 0,1 ml 790 € acr human
AP08613PU-N anti-Aquaporin-2 / AQP2 pSer261 Antibody 0,1 ml 601 € acr human
AP31628PU-N anti-Aquaporin-2 / AQP2 pSer264 Antibody 0,1 ml 601 € acr human
AP31629PU-N anti-Aquaporin-2 / AQP2 pSer269 Antibody 0,1 ml 601 € acr human
GENTAUR-58bdcf8878fa3 Anti- Aquaporin 2, Collecting Duct (AQP2) Antibody 50ug 354 € MBS Polyclonals human
GENTAUR-58bdcf88ec86d Anti- Aquaporin 2, Collecting Duct (AQP2) Antibody 100ug 453 € MBS Polyclonals human
GENTAUR-58bdd37226fb6 Anti- Aquaporin 2, Collecting Duct (AQP2) Antibody 100ug 486 € MBS Polyclonals human
GENTAUR-58bdd6b20d925 Anti- Aquaporin 2, Collecting Duct (AQP2) Antibody 100ug 520 € MBS Polyclonals human
MBS241713 Anti-Human AQP2 / Aquaporin 2 Antibody 50ug 597 € MBS Polyclonals_1 human
R30832 AQP2 Antibody Aquaporin 2 0.1mg 389 € NJS poly human
R32091 AQP2 Antibody / Aquaporin 2 0.1mg 406 € NJS poly human
GENTAUR-58bb4927741b3 Amblysomus hottentotus Aquaporin-2 (AQP2) 1000ug 1337 € MBS Recombinant Proteins human
GENTAUR-58bb4927b8951 Amblysomus hottentotus Aquaporin-2 (AQP2) 1000ug 1846 € MBS Recombinant Proteins human
abx573236 Anti-Rat Aquaporin 2, Collecting Duct (AQP2) ELISA Kit inquire 50 € abbex rat
EKU02542 Aquaporin 2, Collecting Duct (AQP2) ELISA kit 1 plate of 96 wells 745 € Biomatik ELISA kits human
EKU02543 Aquaporin 2, Collecting Duct (AQP2) ELISA kit 1 plate of 96 wells 804 € Biomatik ELISA kits human
GENTAUR-58ba8705ae780 Elephas maximus Aquaporin-2 (AQP2) 1000ug 1337 € MBS Recombinant Proteins human
GENTAUR-58ba870648075 Elephas maximus Aquaporin-2 (AQP2) 1000ug 1846 € MBS Recombinant Proteins human
AE55923HO-48 ELISA test for Horse Aquaporin 2 (AQP2) 1x plate of 48 wells 402 € abebio horse
GENTAUR-58ba7dcfb0e6e Erinaceus europaeus Aquaporin-2 (AQP2) 1000ug 1337 € MBS Recombinant Proteins human
GENTAUR-58ba7dd06b081 Erinaceus europaeus Aquaporin-2 (AQP2) 1000ug 1846 € MBS Recombinant Proteins human
AE55923HO-96 Horse Aquaporin 2 (AQP2) ELISA Kit 1x plate of 96 wells 671 € abebio horse
DL-AQP2-Hu Human Aquaporin 2, Collecting Duct AQP2 ELISA Kit 96T 846 € DL elisas human