MLH1 Antibody

Contact us
Catalog number: R32088
Price: 393 €
Supplier: MBS Polyclonals
Product name: MLH1 Antibody
Quantity: 100ug
Other quantities: 0.08 ml 199€ 0.1ml 263€ 0.4 ml 406€ 1 mililiter Concentrate 945€ 1 vial 585€ 100ug 370€ 100ul Concentrate 299€ 15 ml 641€ 3 ml 288€ 5 + Control Slides 304€ 500ul Concentrate 591€ 7 ml 404€
Related search:

More details :

Category: Antibody
Concentration: 2ml sterile DI water, 5mg/ml if reconstituted with 0
Form: Antigen affinity purified
Conjugation: Unconjugated
Clone: Polyclonal antibody
Recognised antigen: MLH1
Host animal: Rabbit (Oryctolagus cuniculus)
Clonality: Polyclonal (rabbit origin)
Species reactivity: Due to limited knowledge and inability to test the antibody against all known species, Mouse (Mus musculus), Rat , we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens)
Tested applications: WB
Recommended dilutions: 1-0, 5ug/ml, Western blot: 0
Notes: Optimal dilution of the MLH1 antibody should be determined by the researcher
Intented use: This MLH1 antibodyis to be used only for research purposes and not for diagnostics
Uniprot #: P40692
Purity: Antigen affinity
Description: Additional transcript variants have been described, Alternative splicing results in multiple transcript variants encoding distinct isoforms, It is a human homolog of the E, This gene was identified as a locus frequently mutated in hereditary nonpolyposis colon cancer (HNPCC), but their full-length natures have not been determined, coli DNA mismatch repair gene mutL, coli) is a protein that in humans is encoded by the MLH1 gene located on Chromosome 3, colon cancer, consistent with the characteristic alterations in microsatellite sequences (RER+phenotype) found in HNPCC, nonpolyposis type 2 (E, MutL homolog 1
Immunogen: Amino acids KALRSHILPPKHFTEDGNILQLANLPDLYKVFERC of human MLH1 were used as the immunogen for the MLH1 antibody
Storage: Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the MLH1 antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term
Properties: C, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24°
Gene target: MLH1
Short name: MLH1 Antibody
Technique: antibodies against human proteins, antibodies for, Antibody
Alternative name: coli) (Antibody to), colon cancer, nonpolyposis classification 2 (E, mutL homolog 1
Alternative technique: antibodies
Alternative to gene target: COCA2 and FCC2 and hMLH1 and HNPCC and HNPCC2, MLH1 and IDBG-24600 and ENSG00000076242 and 4292, MLH1 and IDBG-644253 and ENSBTAG00000016758 and 533652, Mlh1 and IDBG-202755 and ENSMUSG00000032498 and 17350, coli), colon cancer, nonpolyposis type 2 (E, nuclei, structure-specific DNA binding, this GO :0000289 and nuclear-transcribed mRNA poly(A) tail shortening and biological process this GO :0000712 and resolution of meiotic recombination intermediates and biological process this GO :0000793 and condensed chromosome and cellular component this GO :0000794 and condensed nuclear chromosome and cellular component this GO :0000795 and synaptonemal complex and cellular component this GO :0001673 and male germ cell nucleus and cellular component this GO :0002204 and somatic recombination of immunoglobulin genes involved in immune response and biological process this GO :0003697 and single-stranded DNA binding and molecular function this GO :0005515 and protein binding and molecular function this GO :0005524 and ATP binding and molecular function this GO :0005634 and nucleus and cellular component this GO :0005694 and chromosome and cellular component this GO :0005712 and chiasma and cellular component this GO :0006200 and ATP catabolic process and biological process this GO :0006281 and DNA repair and biological process this GO :0006298 and mismatch repair and biological process this GO :0006303 and double-strand break repair via nonhomolo this GO us end joining and biological process this GO :0006974 and cellular response to DNA damage stimulus and biological process this GO :0007060 and male meiosis chromosome segregation and biological process this GO :0007129 and synapsis and biological process this GO :0007131 and reciprocal meiotic recombination and biological process this GO :0007140 and male meiosis and biological process this GO :0007283 and spermatogenesis and biological process this GO :0008630 and intrinsic apoptotic signaling pathway in response to DNA damage and biological process this GO :0016020 and membrane and cellular component this GO :0016446 and somatic hypermutation of immunoglobulin genes and biological process this GO :0016447 and somatic recombination of immunoglobulin gene segments and biological process this GO :0016887 and ATPase activity and molecular function this GO :0030983 and mismatched DNA binding and molecular function this GO :0032137 and guanine/thymine mispair binding and molecular function this GO :0032300 and mismatch repair complex and cellular component this GO :0032389 and MutLalpha complex and cellular component this GO :0032407 and MutSalpha complex binding and molecular function this GO :0043060 and meiotic metaphase I plate congression and biological process this GO :0043566 and structure-specific DNA binding and molecular function this GO :0045132 and meiotic chromosome segregation and biological process this GO :0045190 and isotype switching and biological process this GO :0045950 and negative regulation of mitotic recombination and biological process this GO :0048477 and oogenesis and biological process this GO :0051257 and spindle midzone assembly involved in meiosis and biological process, this GO :0003697 : single-stranded DNA binding, this GO :0003697 : single-stranded DNA binding and also this GO :0005515 : protein binding and also this GO :0005524 : ATP binding and also this GO :0016887 : ATPase activity and also this GO :0030983 : mismatched DNA binding and also this GO :0032137 : guanine/thymine mispair binding and also this GO :0032407 : MutSalpha complex binding and also this GO :0043566 : structure-specific DNA binding, this GO :0005515 : protein binding, this GO :0005524 : ATP binding, this GO :0016887 : ATPase activity, this GO :0030983 : mismatched DNA binding, this GO :0032137 : guanine/thymine mispair binding, this GO :0032407 : MutSalpha complex binding, this GO :0043566 : structure-specific DNA binding, mutL homolog 1
Identity: 7127
Gene: MLH1 | More about : MLH1
Long gene name: mutL homolog 1
Synonyms gene: COCA2
Synonyms gene name: coli) , coli) homolog 1 (colon cancer, colon cancer, mutL (E, nonpolyposis type 2 (E, nonpolyposis type 2) mutL homolog 1
Synonyms: HNPCC FCC2 HNPCC2
Locus: 3p22, 2
Discovery year: 1993-11-24
GenBank acession: U07418
Entrez gene record: 4292
Pubmed identfication: 7903889
RefSeq identity: NM_000249
Classification: MutL homologs
Havana BLAST/BLAT: OTTHUMG00000130797
Locus Specific Databases: HNPCC Colon cancer gene variant databases MLH1 database at LOVD-China LOVD - Leiden Open Variation Database LRG_216 , Hereditary Non-Polyposis Colorectal Cancer

Related Products :

AE33391RA-48 ELISA test for Rat DNA mismatch repair protein Mlh1 (MLH1) 1x plate of 48 wells 373 € abebio rat
MBS620940 MLH1 (Human Mul L Homolog, Familial Nonpolyposis Colin Cancer Type 2, COCA2, Colon Cancer Type 2, DNA Mismatch Repair Protein Mlh1, FCC2, hMLH1, HNPCC, HNPCC2, MGC5172, MutL Homolog 1, MutL Homolog 1 Colon Cancer Nonpolyposis Type 2, MutL Protein Homolog Antibody 100ug 801 € MBS Polyclonals_1 human
AE33391RA Rat DNA mismatch repair protein Mlh1 (MLH1) ELISA Kit 48 wells plate 480 € ab-elisa elisas rat
AE33391RA-96 Rat DNA mismatch repair protein Mlh1 (MLH1) ELISA Kit 1x plate of 96 wells 612 € abebio rat
GWB-17925D MutL Homolog 1 (colon Cancer Nonpolyposis Type 2) (MLH1) Rabbit antibody to or anti-Human Polyclonal (aa557-756) antibody 1 x 1 vial 648 € genways human
A03M0153 anti-MLH1 Antibody 200ug (50ug, 100ug available) 465 € Bluegen antibodies human
AM06257SU-N anti-MLH1 Antibody 0,1 ml 630 € acr human
AM10114SU-N anti-MLH1 Antibody 1 ml 703 € acr human
AM20522SU-N anti-MLH1 Antibody 50 Вµl 732 € acr human
AP15650PU-M anti-MLH1 Antibody 0,5 ml 572 € acr human
AP15650PU-N anti-MLH1 Antibody 1 ml 804 € acr human
AP15650PU-S anti-MLH1 Antibody 0,1 ml 326 € acr human
AP20490PU-N anti-MLH1 Antibody 0,1 mg 558 € acr human
C13086-1 anti-MLH1 Antibody 50 Вµg 347 € acr human
C13086-2 anti-MLH1 Antibody 0,1 mg 500 € acr human
CPA1742-100ul anti-MLH1 Antibody 0,1 ml 442 € acr human
CPA1742-200ul anti-MLH1 Antibody 0,2 ml 688 € acr human
CPA1742-30ul anti-MLH1 Antibody 30 Вµl 326 € acr human
DM430 anti-MLH1 Antibody 1 ml 964 € acr human
DM430-05 anti-MLH1 Antibody 0,5 ml 645 € acr human
GENTAUR-58bdf48490afe Anti- MLH1 Antibody 0.12 ml 348 € MBS Polyclonals human
GENTAUR-58bdf48508bfe Anti- MLH1 Antibody 0.06 ml 265 € MBS Polyclonals human
GENTAUR-58be0bb38f43a Anti- MLH1 Antibody 0.06 ml 265 € MBS Polyclonals human
GENTAUR-58be0bb445392 Anti- MLH1 Antibody 0.12 ml 348 € MBS Polyclonals human
GENTAUR-58be0c04b39ab Anti- MLH1 Antibody 0.06 ml 265 € MBS Polyclonals human
GENTAUR-58be0c0521add Anti- MLH1 Antibody 0.12 ml 348 € MBS Polyclonals human
GENTAUR-58be3b9926f7b Anti- MLH1 Antibody 100ug 393 € MBS Polyclonals human
GENTAUR-58be3bb8ae5af Anti- MLH1 Antibody 100ug 393 € MBS Polyclonals human
GENTAUR-58be3e4d78af0 Anti- MLH1 Antibody 100ug 393 € MBS Polyclonals human
GENTAUR-58be41254e1b2 Anti- MLH1 Antibody 100ug 393 € MBS Polyclonals human