| Category: |
Antibody |
| Concentration: |
2ml sterile DI water, 5mg/ml if reconstituted with 0 |
| Form: |
Antigen affinity purified |
| Conjugation: |
Unconjugated |
| Clone: |
Polyclonal antibody |
| Recognised antigen: |
MLH1 |
| Host animal: |
Rabbit (Oryctolagus cuniculus) |
| Clonality: |
Polyclonal (rabbit origin) |
| Species reactivity: |
Due to limited knowledge and inability to test the antibody against all known species, Mouse (Mus musculus), Rat , we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens) |
| Tested applications: |
WB |
| Recommended dilutions: |
1-0, 5ug/ml, Western blot: 0 |
| Notes: |
Optimal dilution of the MLH1 antibody should be determined by the researcher |
| Intented use: |
This MLH1 antibodyis to be used only for research purposes and not for diagnostics |
| Uniprot #: |
P40692 |
| Purity: |
Antigen affinity |
| Description: |
Additional transcript variants have been described, Alternative splicing results in multiple transcript variants encoding distinct isoforms, It is a human homolog of the E, This gene was identified as a locus frequently mutated in hereditary nonpolyposis colon cancer (HNPCC), but their full-length natures have not been determined, coli DNA mismatch repair gene mutL, coli) is a protein that in humans is encoded by the MLH1 gene located on Chromosome 3, colon cancer, consistent with the characteristic alterations in microsatellite sequences (RER+phenotype) found in HNPCC, nonpolyposis type 2 (E, MutL homolog 1 |
| Immunogen: |
Amino acids KALRSHILPPKHFTEDGNILQLANLPDLYKVFERC of human MLH1 were used as the immunogen for the MLH1 antibody |
| Storage: |
Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the MLH1 antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term |
| Properties: |
C, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24° |
| Gene target: |
MLH1 |
| Short name: |
MLH1 Antibody |
| Technique: |
antibodies against human proteins, antibodies for, Antibody |
| Alternative name: |
coli) (Antibody to), colon cancer, nonpolyposis classification 2 (E, mutL homolog 1 |
| Alternative technique: |
antibodies |
| Alternative to gene target: |
COCA2 and FCC2 and hMLH1 and HNPCC and HNPCC2, MLH1 and IDBG-24600 and ENSG00000076242 and 4292, MLH1 and IDBG-644253 and ENSBTAG00000016758 and 533652, Mlh1 and IDBG-202755 and ENSMUSG00000032498 and 17350, coli), colon cancer, nonpolyposis type 2 (E, nuclei, structure-specific DNA binding, this GO :0000289 and nuclear-transcribed mRNA poly(A) tail shortening and biological process this GO :0000712 and resolution of meiotic recombination intermediates and biological process this GO :0000793 and condensed chromosome and cellular component this GO :0000794 and condensed nuclear chromosome and cellular component this GO :0000795 and synaptonemal complex and cellular component this GO :0001673 and male germ cell nucleus and cellular component this GO :0002204 and somatic recombination of immunoglobulin genes involved in immune response and biological process this GO :0003697 and single-stranded DNA binding and molecular function this GO :0005515 and protein binding and molecular function this GO :0005524 and ATP binding and molecular function this GO :0005634 and nucleus and cellular component this GO :0005694 and chromosome and cellular component this GO :0005712 and chiasma and cellular component this GO :0006200 and ATP catabolic process and biological process this GO :0006281 and DNA repair and biological process this GO :0006298 and mismatch repair and biological process this GO :0006303 and double-strand break repair via nonhomolo this GO us end joining and biological process this GO :0006974 and cellular response to DNA damage stimulus and biological process this GO :0007060 and male meiosis chromosome segregation and biological process this GO :0007129 and synapsis and biological process this GO :0007131 and reciprocal meiotic recombination and biological process this GO :0007140 and male meiosis and biological process this GO :0007283 and spermatogenesis and biological process this GO :0008630 and intrinsic apoptotic signaling pathway in response to DNA damage and biological process this GO :0016020 and membrane and cellular component this GO :0016446 and somatic hypermutation of immunoglobulin genes and biological process this GO :0016447 and somatic recombination of immunoglobulin gene segments and biological process this GO :0016887 and ATPase activity and molecular function this GO :0030983 and mismatched DNA binding and molecular function this GO :0032137 and guanine/thymine mispair binding and molecular function this GO :0032300 and mismatch repair complex and cellular component this GO :0032389 and MutLalpha complex and cellular component this GO :0032407 and MutSalpha complex binding and molecular function this GO :0043060 and meiotic metaphase I plate congression and biological process this GO :0043566 and structure-specific DNA binding and molecular function this GO :0045132 and meiotic chromosome segregation and biological process this GO :0045190 and isotype switching and biological process this GO :0045950 and negative regulation of mitotic recombination and biological process this GO :0048477 and oogenesis and biological process this GO :0051257 and spindle midzone assembly involved in meiosis and biological process, this GO :0003697 : single-stranded DNA binding, this GO :0003697 : single-stranded DNA binding and also this GO :0005515 : protein binding and also this GO :0005524 : ATP binding and also this GO :0016887 : ATPase activity and also this GO :0030983 : mismatched DNA binding and also this GO :0032137 : guanine/thymine mispair binding and also this GO :0032407 : MutSalpha complex binding and also this GO :0043566 : structure-specific DNA binding, this GO :0005515 : protein binding, this GO :0005524 : ATP binding, this GO :0016887 : ATPase activity, this GO :0030983 : mismatched DNA binding, this GO :0032137 : guanine/thymine mispair binding, this GO :0032407 : MutSalpha complex binding, this GO :0043566 : structure-specific DNA binding, mutL homolog 1 |
| Identity: |
7127 |
| Gene: |
MLH1 |
More about : MLH1 |
| Long gene name: |
mutL homolog 1 |
| Synonyms gene: |
COCA2 |
| Synonyms gene name: |
coli) , coli) homolog 1 (colon cancer, colon cancer, mutL (E, nonpolyposis type 2 (E, nonpolyposis type 2) mutL homolog 1 |
| Synonyms: |
HNPCC FCC2 HNPCC2 |
| Locus: |
3p22, 2 |
| Discovery year: |
1993-11-24 |
| GenBank acession: |
U07418 |
| Entrez gene record: |
4292 |
| Pubmed identfication: |
7903889 |
| RefSeq identity: |
NM_000249 |
| Classification: |
MutL homologs |
| Havana BLAST/BLAT: |
OTTHUMG00000130797 |
| Locus Specific Databases: |
HNPCC Colon cancer gene variant databases MLH1 database at LOVD-China LOVD - Leiden Open Variation Database LRG_216 , Hereditary Non-Polyposis Colorectal Cancer |