GPX4 Antibody (isoforms a/b/c)

Contact us
Catalog number: R32085
Price: 333 €
Supplier: Bioss Primary Conjugated Antibodies
Product name: GPX4 Antibody (isoforms a/b/c)
Quantity: 0.1ml
Related search:

More details :

Category: Antibody
Concentration: 2ml sterile DI water, 5mg/ml if reconstituted with 0
Form: Antigen affinity purified
Conjugation: Unconjugated
Clone: Polyclonal antibody
Recognised antigen: GPX4 (isoforms a/b/c)
Host animal: Rabbit (Oryctolagus cuniculus)
Clonality: Polyclonal (rabbit origin)
Species reactivity: Due to limited knowledge and inability to test the antibody against all known species, Mouse (Mus musculus), Rat , we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens)
Tested applications: IHC-P, WB
Recommended dilutions: 1-0, 5-1ug/ml, 5ug/ml, IHC (Paraffin): 0, Western blot: 0
Notes: Optimal dilution of the GPX4 antibody should be determined by the researcher
Intented use: This GPX4 antibodyis to be used only for research purposes and not for diagnostics
Uniprot #: P36969
Purity: Antigen affinity
Description: Alternative splicing results in multiple transcript variants, Glutathione peroxidase catalyzes the reduction of hydrogen peroxide, Human plasma glutathione peroxidase has been shown to be a selenium-containing enzyme and the UGA codon is translated into a selenocysteine, In humans, The encoded protein has been identified as a moonlighting protein based on its ability to serve dual functions as a peroxidase as well as a structural protein in mature spermatozoa, This gene encodes a member of the glutathione peroxidase protein family, Through alternative splicing and transcription initiation, also known as GPX4, alternative transcription initiation and the cleavage sites of the mitochondrial and nuclear transit peptides need to be experimentally verified, and cytoplasm, and lipid peroxides by reduced glutathione and functions in the protection of cells against oxidative damage, is an enzyme that in humans is encoded by the GPX4 gene, mitochondrion, organic hydroperoxide, rat produces proteins that localize to the nucleus, Glutathione peroxidase 4
Immunogen: Amino acids ASRDDWRCARSMHEFSAKDIDGHMVNLDKYR of human GPX4 were used as the immunogen for the GPX4 antibody
Storage: Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the GPX4 antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term
Localization: cytoplasmic, membrane, Nuclear
Properties: C, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24°
Gene target: GPX4 (isoforms a/b/c)
Short name: GPX4 Antibody (isoforms a/b/c)
Technique: antibodies against human proteins, antibodies for, Antibody
Alternative name: GPX4 (Antibody to) (isoforms a/b/c)
Alternative technique: antibodies
Identity: 4556
Gene: GPX4 | More about : GPX4
Long gene name: glutathione peroxidase 4
Synonyms gene name: glutathione peroxidase 4 (phospholipid hydroperoxidase)
Synonyms: PHGPx MCSP
Synonyms name: phospholipid hydroperoxidase
Locus: 19p13, 3
Discovery year: 1993-05-03
GenBank acession: BC039849 X71973
Entrez gene record: 2879
Pubmed identfication: 8287691 8039723 10464096
RefSeq identity: NM_002085
Classification: Selenoproteins
Havana BLAST/BLAT: OTTHUMG00000181874

Related Products :

R33756-100UG GPX4 Antibody (isoforms a and c) 0.1mg 406 € NJS poly human
R32085 GPX4 Antibody (isoforms a/b/c) 0.1mg 406 € NJS poly human
GWB-A9177F antibody to or anti-Glutathione Peroxidase 4 (Gpx4) antibody 1 vial 667 € genways human
GWB-C5ED80 Phospholipid Hydroperoxide Gluthatione Peroxidase (GPX4) Rabbit antibody to or anti-Human Polyclonal (aa81-93) antibody 1 vial 602 € genways human
AP22541PU-N anti-Glutathione peroxidase 4 / GPX4 (184-196) Antibody 50 Вµg 732 € acr human
AP55263SU-N anti-Glutathione peroxidase 4 / GPX4 Antibody 0,2 ml 630 € acr human
GENTAUR-58bdc2ba41d7b Anti- Glutathione Peroxidase 4 (GPX4) Antibody 100ug 503 € MBS Polyclonals human
GENTAUR-58bdc2ba99f10 Anti- Glutathione Peroxidase 4 (GPX4) Antibody 50ug 382 € MBS Polyclonals human
GENTAUR-58bdc5233c12a Anti- Glutathione Peroxidase 4 (GPX4) Antibody 50ug 376 € MBS Polyclonals human
GENTAUR-58bdc523adbe8 Anti- Glutathione Peroxidase 4 (GPX4) Antibody 100ug 492 € MBS Polyclonals human
GENTAUR-58bdd1fa179fa Anti- Glutathione Peroxidase 4 (GPX4) Antibody 100ug 542 € MBS Polyclonals human
GENTAUR-58bdd33fb25f8 Anti- Glutathione Peroxidase 4 (GPX4) Antibody 100ug 525 € MBS Polyclonals human
GENTAUR-58bdd608db7fe Anti- Glutathione Peroxidase 4 (GPX4) Antibody 100ug 575 € MBS Polyclonals human
GENTAUR-58bdd844b33f6 Anti- Glutathione Peroxidase 4 (GPX4) Antibody 100ug 564 € MBS Polyclonals human
AP05692PU-N anti-Glutathione peroxidase 4 / GPX4 (C-term) Antibody 50 Вµg 572 € acr human
GENTAUR-58bdef5aa6877 Anti- GPX4 Antibody 0.06 ml 265 € MBS Polyclonals human
GENTAUR-58bdef5b21fc7 Anti- GPX4 Antibody 0.12 ml 348 € MBS Polyclonals human
GENTAUR-58bdfe5acbcd5 Anti- GPX4 Antibody 0.12 ml 348 € MBS Polyclonals human
GENTAUR-58bdfe5c8239c Anti- GPX4 Antibody 0.06 ml 265 € MBS Polyclonals human
GENTAUR-58be3ec1991b7 Anti- GPX4 Antibody 100ug 393 € MBS Polyclonals human
abx216764 Anti-GPX4 Antibody 100 μg 311 € abbex human
MBS420590 Goat anti-GPX4 (Isoform a and c) Antibody 100ug 370 € MBS Polyclonals_1 human
MBS242691 Goat Polyclonal to Human GPX4 / MCSP Antibody 50ug 597 € MBS Polyclonals_1 human
GWB-MV264C GPX4 antibody 1 vial 521 € genways human
bs-3884R-A350 GPX4 Antibody, ALEXA FLUOR 350 100ul 332 € Bioss Primary Conjugated Antibodies. human
bs-3884R-A488 GPX4 Antibody, ALEXA FLUOR 488 100ul 332 € Bioss Primary Conjugated Antibodies. human
bs-3884R-A555 GPX4 Antibody, ALEXA FLUOR 555 100ul 332 € Bioss Primary Conjugated Antibodies. human
bs-3884R-A594 GPX4 Antibody, ALEXA FLUOR 594 100ul 332 € Bioss Primary Conjugated Antibodies. human
bs-3884R-A647 GPX4 Antibody, ALEXA FLUOR 647 100ul 332 € Bioss Primary Conjugated Antibodies. human
bs-3884R-Biotin GPX4 Antibody, Biotin Conjugated 0.1ml 333 € Bioss Primary Conjugated Antibodies human