| Category: |
Antibody |
| Concentration: |
2ml sterile DI water, 5mg/ml if reconstituted with 0 |
| Form: |
Antigen affinity purified |
| Conjugation: |
Unconjugated |
| Clone: |
Polyclonal antibody |
| Recognised antigen: |
GPX4 (isoforms a/b/c) |
| Host animal: |
Rabbit (Oryctolagus cuniculus) |
| Clonality: |
Polyclonal (rabbit origin) |
| Species reactivity: |
Due to limited knowledge and inability to test the antibody against all known species, Mouse (Mus musculus), Rat , we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens) |
| Tested applications: |
IHC-P, WB |
| Recommended dilutions: |
1-0, 5-1ug/ml, 5ug/ml, IHC (Paraffin): 0, Western blot: 0 |
| Notes: |
Optimal dilution of the GPX4 antibody should be determined by the researcher |
| Intented use: |
This GPX4 antibodyis to be used only for research purposes and not for diagnostics |
| Uniprot #: |
P36969 |
| Purity: |
Antigen affinity |
| Description: |
Alternative splicing results in multiple transcript variants, Glutathione peroxidase catalyzes the reduction of hydrogen peroxide, Human plasma glutathione peroxidase has been shown to be a selenium-containing enzyme and the UGA codon is translated into a selenocysteine, In humans, The encoded protein has been identified as a moonlighting protein based on its ability to serve dual functions as a peroxidase as well as a structural protein in mature spermatozoa, This gene encodes a member of the glutathione peroxidase protein family, Through alternative splicing and transcription initiation, also known as GPX4, alternative transcription initiation and the cleavage sites of the mitochondrial and nuclear transit peptides need to be experimentally verified, and cytoplasm, and lipid peroxides by reduced glutathione and functions in the protection of cells against oxidative damage, is an enzyme that in humans is encoded by the GPX4 gene, mitochondrion, organic hydroperoxide, rat produces proteins that localize to the nucleus, Glutathione peroxidase 4 |
| Immunogen: |
Amino acids ASRDDWRCARSMHEFSAKDIDGHMVNLDKYR of human GPX4 were used as the immunogen for the GPX4 antibody |
| Storage: |
Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the GPX4 antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term |
| Localization: |
cytoplasmic, membrane, Nuclear |
| Properties: |
C, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24° |
| Gene target: |
GPX4 (isoforms a/b/c) |
| Short name: |
GPX4 Antibody (isoforms a/b/c) |
| Technique: |
antibodies against human proteins, antibodies for, Antibody |
| Alternative name: |
GPX4 (Antibody to) (isoforms a/b/c) |
| Alternative technique: |
antibodies |
| Identity: |
4556 |
| Gene: |
GPX4 |
More about : GPX4 |
| Long gene name: |
glutathione peroxidase 4 |
| Synonyms gene name: |
glutathione peroxidase 4 (phospholipid hydroperoxidase) |
| Synonyms: |
PHGPx MCSP |
| Synonyms name: |
phospholipid hydroperoxidase |
| Locus: |
19p13, 3 |
| Discovery year: |
1993-05-03 |
| GenBank acession: |
BC039849 X71973 |
| Entrez gene record: |
2879 |
| Pubmed identfication: |
8287691 8039723 10464096 |
| RefSeq identity: |
NM_002085 |
| Classification: |
Selenoproteins |
| Havana BLAST/BLAT: |
OTTHUMG00000181874 |