| Category: |
Antibody |
| Concentration: |
2ml sterile DI water, 5mg/ml if reconstituted with 0 |
| Form: |
Antigen affinity purified |
| Conjugation: |
Unconjugated |
| Clone: |
Polyclonal antibody |
| Recognised antigen: |
Connexin 45 / GJC1 |
| Host animal: |
Rabbit (Oryctolagus cuniculus) |
| Clonality: |
Polyclonal (rabbit origin) |
| Species reactivity: |
Due to limited knowledge and inability to test the antibody against all known species, Rat , we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens) |
| Tested applications: |
WB |
| Recommended dilutions: |
1-0, 5ug/ml, Western blot: 0 |
| Notes: |
Optimal dilution of the Connexin 45 antibody should be determined by the researcher |
| Intented use: |
This Connexin 45 antibodyis to be used only for research purposes and not for diagnostics |
| Uniprot #: |
P36383 |
| Purity: |
Antigen affinity |
| Description: |
The International Radiation Hybrid Mapping Consortium mapped the GJA7 gene to chromosome 17q21, The encoded protein is a component of gap junctions, This gene is a member of the connexin gene family, also known as gap junction alpha-7 protein (GJA7) or connexin 45 (Cx45), is a protein that in humans is encoded by the GJC1 gene, which are composed of arrays of intercellular channels that provide a route for the diffusion of low molecular weight materials from cell to cell, 31, Gap junction gamma-1 protein (GJC1) |
| Immunogen: |
Amino acids ADLEALQREIRMAQERLDLAVQAYSHQNNP H of human Connexin 45/GJA7 were used as the immunogen for the Connexin 45 antibody |
| Storage: |
Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the Connexin 45 antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term |
| Properties: |
C, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24° |
| Gene target: |
Connexin 45 / GJC1 |
| Short name: |
Connexin 45 Antibody / GJC1 |
| Technique: |
antibodies against human proteins, antibodies for, Antibody |
| Alternative name: |
Connexin 45 (Antibody to) / GJC1 |
| Alternative technique: |
antibodies |
| Identity: |
4280 |
| Gene: |
GJC1 |
More about : GJC1 |
| Long gene name: |
gap junction protein gamma 1 |
| Synonyms gene: |
GJA7 |
| Synonyms gene name: |
45kDa , 45kDa gap junction protein, alpha 7, gamma 1, gap junction protein |
| Synonyms: |
CX45 |
| Synonyms name: |
connexin 45 |
| Locus: |
17q21, 31 |
| Discovery year: |
1999-07-30 |
| GenBank acession: |
U03493 |
| Entrez gene record: |
10052 |
| Pubmed identfication: |
7966354 |
| RefSeq identity: |
NM_005497 |
| Classification: |
Gap junction proteins |
| Havana BLAST/BLAT: |
OTTHUMG00000179861 |