Connexin 45 Antibody / GJC1

Contact us
Catalog number: R32083
Price: 2575 €
Supplier: MBS Recombinant Proteins
Product name: Connexin 45 Antibody / GJC1
Quantity: 1000ug
Related search:

More details :

Category: Antibody
Concentration: 2ml sterile DI water, 5mg/ml if reconstituted with 0
Form: Antigen affinity purified
Conjugation: Unconjugated
Clone: Polyclonal antibody
Recognised antigen: Connexin 45 / GJC1
Host animal: Rabbit (Oryctolagus cuniculus)
Clonality: Polyclonal (rabbit origin)
Species reactivity: Due to limited knowledge and inability to test the antibody against all known species, Rat , we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens)
Tested applications: WB
Recommended dilutions: 1-0, 5ug/ml, Western blot: 0
Notes: Optimal dilution of the Connexin 45 antibody should be determined by the researcher
Intented use: This Connexin 45 antibodyis to be used only for research purposes and not for diagnostics
Uniprot #: P36383
Purity: Antigen affinity
Description: The International Radiation Hybrid Mapping Consortium mapped the GJA7 gene to chromosome 17q21, The encoded protein is a component of gap junctions, This gene is a member of the connexin gene family, also known as gap junction alpha-7 protein (GJA7) or connexin 45 (Cx45), is a protein that in humans is encoded by the GJC1 gene, which are composed of arrays of intercellular channels that provide a route for the diffusion of low molecular weight materials from cell to cell, 31, Gap junction gamma-1 protein (GJC1)
Immunogen: Amino acids ADLEALQREIRMAQERLDLAVQAYSHQNNP H of human Connexin 45/GJA7 were used as the immunogen for the Connexin 45 antibody
Storage: Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the Connexin 45 antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term
Properties: C, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24°
Gene target: Connexin 45 / GJC1
Short name: Connexin 45 Antibody / GJC1
Technique: antibodies against human proteins, antibodies for, Antibody
Alternative name: Connexin 45 (Antibody to) / GJC1
Alternative technique: antibodies
Identity: 4280
Gene: GJC1 | More about : GJC1
Long gene name: gap junction protein gamma 1
Synonyms gene: GJA7
Synonyms gene name: 45kDa , 45kDa gap junction protein, alpha 7, gamma 1, gap junction protein
Synonyms: CX45
Synonyms name: connexin 45
Locus: 17q21, 31
Discovery year: 1999-07-30
GenBank acession: U03493
Entrez gene record: 10052
Pubmed identfication: 7966354
RefSeq identity: NM_005497
Classification: Gap junction proteins
Havana BLAST/BLAT: OTTHUMG00000179861

Related Products :

R32083 Connexin 45 Antibody / GJC1 0.1mg 406 € NJS poly human
R31329 GJC1 Antibody (Connexin 45) 0.1mg 389 € NJS poly human
MBS248865 Anti-Human GJC1 / CX45 / Connexin 45 50ug 597 € MBS Polyclonals_1 human
MBS248757 PAb (IgG) to Human GJC1 / CX45 / Connexin 45 50ug 597 € MBS Polyclonals_1 human
MBS624330 Connexin 46, NT (Gap Junction alpha-3 Protein, Connexin-46, Cx46, GJA3) Antibody 200ul 603 € MBS Polyclonals_1 human
A03G0070 anti-GJC1 Antibody 200ug (50ug, 100ug available) 465 € Bluegen antibodies human
GENTAUR-58bdfe6a39196 Anti- GJC1 Antibody 0.12 ml 348 € MBS Polyclonals human
GENTAUR-58bdfe6aa3ef7 Anti- GJC1 Antibody 0.06 ml 265 € MBS Polyclonals human
GENTAUR-58be0b057f330 Anti- GJC1 Antibody 0.12 ml 348 € MBS Polyclonals human
GENTAUR-58be0b06136c8 Anti- GJC1 Antibody 0.06 ml 265 € MBS Polyclonals human
abx215546 Anti-GJC1 Antibody inquire 50 € abbex human
AP20594PU-N anti-GJC1 / Cx45 Antibody 0,1 mg 558 € acr human
AP11580PU-N anti-GJC1 / Cx45 (N-term) Antibody 0,4 ml 587 € acr human
GWB-E9B600 GJC1 antibody 1 vial 411 € genways human
GWB-MM435C GJC1 antibody 1 vial 521 € genways human
MBS129941 GJC1 Antibody 200ug 558 € MBS Polyclonals_1 human
abx902171 Anti-GJC1 siRNA inquire 50 € abbex human
abx917942 Anti-GJC1 siRNA inquire 50 € abbex human
abx917943 Anti-GJC1 siRNA inquire 50 € abbex human
AE42066PI-48 ELISA test for Pig Gap junction gamma-1 protein (GJC1) 1x plate of 48 wells 402 € abebio pig
LV169871 GJC1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV) 1.0 µg DNA 517 € ABM lentivectors human
LV169872 GJC1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-C-term-HA) 1.0 µg DNA 517 € ABM lentivectors human
LV169873 GJC1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro) 1.0 µg DNA 517 € ABM lentivectors human
LV169874 GJC1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro) 1.0 µg DNA 517 € ABM lentivectors human
LV169876 GJC1 Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a) 1.0 µg DNA 517 € ABM lentivectors human
LV169875 GJC1 Lentiviral Vector (Human) (UbC) (pLenti-GIII-UbC) 1.0 µg DNA 517 € ABM lentivectors human
GENTAUR-58b9a1ba275c2 Pig Gap junction gamma-1 protein (GJC1) 1000ug 2067 € MBS Recombinant Proteins pig
GENTAUR-58b9a1ba944f4 Pig Gap junction gamma-1 protein (GJC1) 1000ug 2575 € MBS Recombinant Proteins pig
GENTAUR-58ba1a0c3f7c0 Pig Gap junction gamma-1 protein (GJC1) 1000ug 2067 € MBS Recombinant Proteins pig
GENTAUR-58ba1a0ccacdd Pig Gap junction gamma-1 protein (GJC1) 1000ug 2575 € MBS Recombinant Proteins pig