STIP1 Antibody

Contact us
Catalog number: R32069
Price: Ask price €
Supplier: accurate-monoclonals
Product name: STIP1 Antibody
Quantity: 0.1 mg
Other quantities: 0.1ml 263€ 1 vial 411€ 100ul 426€
Related search:

More details :

Category: Antibody
Concentration: 2ml sterile DI water, 5mg/ml if reconstituted with 0
Form: Antigen affinity purified
Conjugation: Unconjugated
Clone: Polyclonal antibody
Recognised antigen: STIP1
Host animal: Rabbit (Oryctolagus cuniculus)
Clonality: Polyclonal (rabbit origin)
Species reactivity: Due to limited knowledge and inability to test the antibody against all known species, Rat , we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens)
Tested applications: WB
Recommended dilutions: 1-0, 5ug/ml, Western blot: 0
Notes: Optimal dilution of the STIP1 antibody should be determined by the researcher
Intented use: This STIP1 antibodyis to be used only for research purposes and not for diagnostics
Uniprot #: P31948
Purity: Antigen affinity
Description: It is thought to assist in the transfer of proteins from HSP70 to HSP90 by binding both HSP90 and substrate-bound HSP70, STIP1 also stimulates the ATPase activity of HSP70 and inhibits the ATPase activity of HSP90, The International Radiation Hybrid Mapping Consortium mapped the STIP1 gene to 11q13, suggesting that it regulates both the conformations and ATPase cycles of these chaperones, STIP1 is an adaptor protein that coordinates the functions of HSP70 and HSP90 in protein folding
Immunogen: Amino acids RLILEQMQKDPQALSEHLKNPVIAQKIQKLMDVGLIAIR of human STIP1 were used as the immunogen for the STIP1 antibody
Storage: Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the STIP1 antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term
Properties: C, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24°
Gene target: STIP1
Short name: STIP1 Antibody
Technique: antibodies against human proteins, antibodies for, Antibody
Alternative name: STIP1 (Antibody to)
Alternative technique: antibodies
Identity: 11387
Gene: STIP1 | More about : STIP1
Long gene name: stress induced phosphoprotein 1
Synonyms gene name: stress-induced-phosphoprotein 1
Synonyms: HOP STI1
Synonyms name: Hsp70/Hsp90-organizing protein
Locus: 11q13, 1
Discovery year: 1999-08-25
GenBank acession: BC039299
Entrez gene record: 10963
Pubmed identfication: 1569099
RefSeq identity: NM_006819
Classification: Tetratricopeptide repeat domain containing
Havana BLAST/BLAT: OTTHUMG00000167789

Related Products :

AR09309PU-L anti-STIP1 (1-543, His-tag) Antibody 0,5 mg 2225 € acr human
AR09309PU-N anti-STIP1 (1-543, His-tag) Antibody 0,1 mg 804 € acr human
GENTAUR-58bdffbe57f9e Anti- STIP1 Antibody 0.12 ml 348 € MBS Polyclonals human
GENTAUR-58bdffbeb6b2e Anti- STIP1 Antibody 0.06 ml 265 € MBS Polyclonals human
GENTAUR-58be11976579f Anti- STIP1 Antibody 0.06 ml 265 € MBS Polyclonals human
GENTAUR-58be1197c2362 Anti- STIP1 Antibody 0.12 ml 348 € MBS Polyclonals human
GENTAUR-58be467d6c8ea Anti- STIP1 Antibody 100ug 393 € MBS Polyclonals human
XW-7680 anti-STIP1 Antibody 0.05 mg 180 € proscience human
abx142249 Anti-STIP1 Antibody 200 μl 514 € abbex human
abx146907 Anti-StIp1 Antibody 100 μg 311 € abbex human
abx147246 Anti-STIP1 Antibody inquire 50 € abbex human
GWB-C3E55D STIP1 antibody 1 vial 411 € genways human
GWB-MQ361A STIP1 antibody 1 vial 440 € genways human
MBS272816 STIP1 antibody 100ul 426 € MBS Polyclonals_1 human
MBS275280 STIP1 antibody 100ul 426 € MBS Polyclonals_1 human
R32069 STIP1 Antibody 0.1mg 406 € NJS poly human
bs-9600R-A350 STIP1 Antibody, ALEXA FLUOR 350 100ul 332 € Bioss Primary Conjugated Antibodies. human
bs-9600R-A488 STIP1 Antibody, ALEXA FLUOR 488 100ul 332 € Bioss Primary Conjugated Antibodies. human
bs-9600R-A555 STIP1 Antibody, ALEXA FLUOR 555 100ul 332 € Bioss Primary Conjugated Antibodies. human
bs-9600R-A594 STIP1 Antibody, ALEXA FLUOR 594 100ul 332 € Bioss Primary Conjugated Antibodies. human
bs-9600R-A647 STIP1 Antibody, ALEXA FLUOR 647 100ul 332 € Bioss Primary Conjugated Antibodies. human
bs-9600R-Biotin STIP1 Antibody, Biotin Conjugated 0.1ml 333 € Bioss Primary Conjugated Antibodies human
bs-9600R STIP1 Antibody 0.1ml 263 € Bioss Primary Unconjugated Antibodies human
bs-9600R-Cy3 STIP1 Antibody, Cy3 Conjugated 0.1ml 350 € Bioss Primary Conjugated Antibodies human
bs-9600R-Cy5 STIP1 Antibody, Cy5 Conjugated 0.1ml 350 € Bioss Primary Conjugated Antibodies human
bs-9600R-Cy5.5 STIP1 Antibody, Cy5.5 Conjugated 0.1ml 350 € Bioss Primary Conjugated Antibodies human
bs-9600R-Cy7 STIP1 Antibody, Cy7 Conjugated 0.1ml 350 € Bioss Primary Conjugated Antibodies human
bs-9600R-FITC STIP1 Antibody, FITC Conjugated 0.1ml 333 € Bioss Primary Conjugated Antibodies human
bs-9600R-HRP STIP1 Antibody, HRP Conjugated 0.1ml 350 € Bioss Primary Conjugated Antibodies human
YSRTMCA5600Z STIP1, Mouse Monoclonal antibody-; Clone: 1E3 0.1 mg Ask price € accurate-monoclonals mouse