| Category: |
Antibody |
| Concentration: |
2ml sterile DI water, 5mg/ml if reconstituted with 0 |
| Form: |
Antigen affinity purified |
| Conjugation: |
Unconjugated |
| Clone: |
Polyclonal antibody |
| Recognised antigen: |
STIP1 |
| Host animal: |
Rabbit (Oryctolagus cuniculus) |
| Clonality: |
Polyclonal (rabbit origin) |
| Species reactivity: |
Due to limited knowledge and inability to test the antibody against all known species, Rat , we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens) |
| Tested applications: |
WB |
| Recommended dilutions: |
1-0, 5ug/ml, Western blot: 0 |
| Notes: |
Optimal dilution of the STIP1 antibody should be determined by the researcher |
| Intented use: |
This STIP1 antibodyis to be used only for research purposes and not for diagnostics |
| Uniprot #: |
P31948 |
| Purity: |
Antigen affinity |
| Description: |
It is thought to assist in the transfer of proteins from HSP70 to HSP90 by binding both HSP90 and substrate-bound HSP70, STIP1 also stimulates the ATPase activity of HSP70 and inhibits the ATPase activity of HSP90, The International Radiation Hybrid Mapping Consortium mapped the STIP1 gene to 11q13, suggesting that it regulates both the conformations and ATPase cycles of these chaperones, STIP1 is an adaptor protein that coordinates the functions of HSP70 and HSP90 in protein folding |
| Immunogen: |
Amino acids RLILEQMQKDPQALSEHLKNPVIAQKIQKLMDVGLIAIR of human STIP1 were used as the immunogen for the STIP1 antibody |
| Storage: |
Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the STIP1 antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term |
| Properties: |
C, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24° |
| Gene target: |
STIP1 |
| Short name: |
STIP1 Antibody |
| Technique: |
antibodies against human proteins, antibodies for, Antibody |
| Alternative name: |
STIP1 (Antibody to) |
| Alternative technique: |
antibodies |
| Identity: |
11387 |
| Gene: |
STIP1 |
More about : STIP1 |
| Long gene name: |
stress induced phosphoprotein 1 |
| Synonyms gene name: |
stress-induced-phosphoprotein 1 |
| Synonyms: |
HOP STI1 |
| Synonyms name: |
Hsp70/Hsp90-organizing protein |
| Locus: |
11q13, 1 |
| Discovery year: |
1999-08-25 |
| GenBank acession: |
BC039299 |
| Entrez gene record: |
10963 |
| Pubmed identfication: |
1569099 |
| RefSeq identity: |
NM_006819 |
| Classification: |
Tetratricopeptide repeat domain containing |
| Havana BLAST/BLAT: |
OTTHUMG00000167789 |