PKLR Antibody

Contact us
Catalog number: R32061
Price: 602 €
Supplier: genways
Product name: PKLR Antibody
Quantity: 1 x 1 vial
Other quantities: 1 vial 440€
Related search:

More details :

Category: Antibody
Concentration: 2ml sterile DI water, 5mg/ml if reconstituted with 0
Form: Antigen affinity purified
Conjugation: Unconjugated
Clone: Polyclonal antibody
Recognised antigen: PKLR
Host animal: Rabbit (Oryctolagus cuniculus)
Clonality: Polyclonal (rabbit origin)
Species reactivity: Due to limited knowledge and inability to test the antibody against all known species, Mouse (Mus musculus), Rat , we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens)
Tested applications: IHC-P, WB
Recommended dilutions: 1-0, 5-1ug/ml, 5ug/ml, IHC (Paraffin): 0, Western blot: 0
Notes: Optimal dilution of the PKLR antibody should be determined by the researcher
Intented use: This PKLR antibodyis to be used only for research purposes and not for diagnostics
Uniprot #: P30613
Purity: Antigen affinity
Description: Defects in this enzyme, It is mapped to 1q21, Multiple transcript variants encoding different isoforms have been found for this gene, The protein encoded by this gene is a pyruvate kinase that catalyzes the transphosphorylation of phohsphoenolpyruvate into pyruvate and ATP, are the common cause of chronic hereditary nonspherocytic hemolytic anemia (CNSHA or HNSHA), due to gene mutations or genetic variations, which is the rate-limiting step of glycolysis, Pyruvate kinase isozymes R/L is an enzyme that in humans is encoded by the PKLR gene
Immunogen: Amino acids EAIWADDVDRRVQFGIESGKLRGFLRVGDLV of human PKLR were used as the immunogen for the PKLR antibody
Storage: Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the PKLR antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term
Localization: Cytoplasmic
Properties: C, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24°
Gene target: PKLR
Short name: PKLR Antibody
Technique: antibodies against human proteins, antibodies for, Antibody
Alternative name: PKLR (Antibody to)
Alternative technique: antibodies
Identity: 9020
Gene: PKLR | More about : PKLR
Long gene name: liver and RBC , pyruvate kinase
Locus: 1q22
Discovery year: 2001-06-22
GenBank acession: BC025737 M15465
Entrez gene record: 5313
Pubmed identfication: 3566732
RefSeq identity: NM_000298
Havana BLAST/BLAT: OTTHUMG00000035875

Related Products :

AR09652PU-L anti-PKLR (47-574, His-tag) Antibody 0,25 mg 1500 € acr human
AR09652PU-N anti-PKLR (47-574, His-tag) Antibody 50 Вµg 587 € acr human
AM09397PU-N anti-PKLR Antibody 0,1 ml 500 € acr human
AM09397PU-S anti-PKLR Antibody 50 Вµl 384 € acr human
CPA2995-100ul anti-PKLR Antibody 0,1 ml 442 € acr human
CPA2995-200ul anti-PKLR Antibody 0,2 ml 688 € acr human
CPA2995-30ul anti-PKLR Antibody 30 Вµl 326 € acr human
GENTAUR-58be3e245a6d1 Anti- PKLR Antibody 100ug 393 € MBS Polyclonals human
AP13594PU-N anti-PKLR (C-term) Antibody 0,4 ml 587 € acr human
AP13593PU-N anti-PKLR (N-term) Antibody 0,4 ml 587 € acr human
GWB-MN920B PKLR antibody 1 vial 440 € genways human
R32061 PKLR Antibody 0.1mg 406 € NJS poly human
GWB-DY0083 PKLR antibody (clone AT1E3) bulk Ask price € genways bulk human
CEL-005313-B01 PKLR MaxPab Mouse Polyclonal Antibody (B01) 0.05ml 495 € Zyagen mouse
MBS126315 PKLR Polyclonal Antibody 50ug 304 € MBS Polyclonals_1 human
CEL-005313-B01P PKLR purified MaxPab Mouse Polyclonal Antibody (B01P) 0.05mg 495 € Zyagen mouse
abx928739 Anti-PKLR siRNA inquire 50 € abbex human
abx928740 Anti-PKLR siRNA inquire 50 € abbex human
GWB-P1324K PKLR, 47-574aa, Recombinant Protein bulk Ask price € genways bulk human
GWB-BSP365 PKLR Human Protein bulk Ask price € genways bulk human
LV263647 PKLR Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV) 1.0 µg DNA 322 € ABM lentivectors human
GWB-364271 PKLR Over-expression Lysate reagent 1 x 1 vial 463 € genways human
GWB-PS628F PKLR Var1 (PKR), Active Human recombinant protein 1 vial 701 € genways human
GWB-PSF97D PKLR Var2 (PKL), Active Human recombinant protein 1 vial 701 € genways human
GENTAUR-58ba5efb65f10 Rat Pyruvate kinase isozymes R/L (Pklr) 100ug 2575 € MBS Recombinant Proteins rat
GENTAUR-58ba5efbd749a Rat Pyruvate kinase isozymes R/L (Pklr) 1000ug 2575 € MBS Recombinant Proteins rat
GENTAUR-58ba5efc45391 Rat Pyruvate kinase isozymes R/L (Pklr) 100ug 3089 € MBS Recombinant Proteins rat
GENTAUR-58ba5efcddc10 Rat Pyruvate kinase isozymes R/L (Pklr) 1000ug 3089 € MBS Recombinant Proteins rat
C954 Recombinant Human Pyruvate Kinase, Liver And RBC, PKLR (C-6His) 10 µg 156 € novo human
GWB-4E3CF6 antibody to or anti- CXC Chemokine Receptor 4 (CXCR4) Rabbit antibody to or anti-Human Polyclonal antibody antibody 1 x 1 vial 602 € genways human