| Category: |
Antibody |
| Concentration: |
2ml sterile DI water, 5mg/ml if reconstituted with 0 |
| Form: |
Antigen affinity purified |
| Conjugation: |
Unconjugated |
| Clone: |
Polyclonal antibody |
| Recognised antigen: |
PKLR |
| Host animal: |
Rabbit (Oryctolagus cuniculus) |
| Clonality: |
Polyclonal (rabbit origin) |
| Species reactivity: |
Due to limited knowledge and inability to test the antibody against all known species, Mouse (Mus musculus), Rat , we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens) |
| Tested applications: |
IHC-P, WB |
| Recommended dilutions: |
1-0, 5-1ug/ml, 5ug/ml, IHC (Paraffin): 0, Western blot: 0 |
| Notes: |
Optimal dilution of the PKLR antibody should be determined by the researcher |
| Intented use: |
This PKLR antibodyis to be used only for research purposes and not for diagnostics |
| Uniprot #: |
P30613 |
| Purity: |
Antigen affinity |
| Description: |
Defects in this enzyme, It is mapped to 1q21, Multiple transcript variants encoding different isoforms have been found for this gene, The protein encoded by this gene is a pyruvate kinase that catalyzes the transphosphorylation of phohsphoenolpyruvate into pyruvate and ATP, are the common cause of chronic hereditary nonspherocytic hemolytic anemia (CNSHA or HNSHA), due to gene mutations or genetic variations, which is the rate-limiting step of glycolysis, Pyruvate kinase isozymes R/L is an enzyme that in humans is encoded by the PKLR gene |
| Immunogen: |
Amino acids EAIWADDVDRRVQFGIESGKLRGFLRVGDLV of human PKLR were used as the immunogen for the PKLR antibody |
| Storage: |
Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the PKLR antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term |
| Localization: |
Cytoplasmic |
| Properties: |
C, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24° |
| Gene target: |
PKLR |
| Short name: |
PKLR Antibody |
| Technique: |
antibodies against human proteins, antibodies for, Antibody |
| Alternative name: |
PKLR (Antibody to) |
| Alternative technique: |
antibodies |
| Identity: |
9020 |
| Gene: |
PKLR |
More about : PKLR |
| Long gene name: |
liver and RBC , pyruvate kinase |
| Locus: |
1q22 |
| Discovery year: |
2001-06-22 |
| GenBank acession: |
BC025737 M15465 |
| Entrez gene record: |
5313 |
| Pubmed identfication: |
3566732 |
| RefSeq identity: |
NM_000298 |
| Havana BLAST/BLAT: |
OTTHUMG00000035875 |