| Category: |
Antibody |
| Concentration: |
2ml sterile DI water, 5mg/ml if reconstituted with 0 |
| Form: |
Antigen affinity purified |
| Conjugation: |
Unconjugated |
| Clone: |
Polyclonal antibody |
| Recognised antigen: |
Phospholamban / PLN |
| Host animal: |
Rabbit (Oryctolagus cuniculus) |
| Clonality: |
Polyclonal (rabbit origin) |
| Species reactivity: |
Due to limited knowledge and inability to test the antibody against all known species, Mouse (Mus musculus), Rat , we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens) |
| Tested applications: |
WB |
| Recommended dilutions: |
1-0, 5ug/ml, Western blot: 0 |
| Notes: |
Optimal dilution of the PLN antibody should be determined by the researcher |
| Intented use: |
This PLN antibodyis to be used only for research purposes and not for diagnostics |
| Uniprot #: |
P26678 |
| Purity: |
Antigen affinity |
| Description: |
Comparison of the human to other mammalian phospholamban genes indicated a marked conservation of sequence for at least 217 bp upstream of the transcription start site, It is observed that human ventricle and quadriceps displayed high levels of phospholamban transcripts and proteins, Phospholamban is also expressed in slow-twitch skeletal muscle and some smooth muscle cells, The structure of the human phospholamban gene closely resembles that reported for chicken, The subsequent activation of the Ca(2+) pump leads to enhanced muscle relaxation rates, and mouse, rabbit, rat, thereby contributing to the inotropic response elicited in heart by beta-agonists, while the right atrium also expressed low levels of phospholamban, with markedly lower expression observed in smooth muscles, Phospholamban is a 52 amino acid integral membrane protein that regulates the Ca2+ pump in cardiac muscle and skeletal muscle cells |
| Immunogen: |
Amino acids MEKVQYLTRSAIRRASTIEMPQQARQKLQNLFINF of human PLN were used as the immunogen for the PLN antibody |
| Storage: |
Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the PLN antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term |
| Properties: |
C, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24° |
| Gene target: |
Phospholamban / PLN |
| Short name: |
Phospholamban Antibody / PLN |
| Technique: |
antibodies against human proteins, antibodies for, Antibody |
| Alternative name: |
Phospholamban (Antibody to) / PLN |
| Alternative technique: |
antibodies |
| Identity: |
9080 |
| Gene: |
PLN |
More about : PLN |
| Long gene name: |
phospholamban |
| Synonyms gene: |
PLB |
| Synonyms: |
CMD1P |
| Locus: |
6q22, 31 |
| Discovery year: |
1991-08-22 |
| Entrez gene record: |
5350 |
| Pubmed identfication: |
1828805 |
| RefSeq identity: |
NM_002667 |
| Havana BLAST/BLAT: |
OTTHUMG00000015462 |
| Locus Specific Databases: |
LRG_390 |