Phospholamban Antibody / PLN

Contact us
Catalog number: R32038
Price: 50 €
Supplier: abbex
Product name: Phospholamban Antibody / PLN
Quantity: inquire
Other quantities: 0.08 ml 199€ 0.1mg 389€ 0.4 ml 406€
Related search:

More details :

Category: Antibody
Concentration: 2ml sterile DI water, 5mg/ml if reconstituted with 0
Form: Antigen affinity purified
Conjugation: Unconjugated
Clone: Polyclonal antibody
Recognised antigen: Phospholamban / PLN
Host animal: Rabbit (Oryctolagus cuniculus)
Clonality: Polyclonal (rabbit origin)
Species reactivity: Due to limited knowledge and inability to test the antibody against all known species, Mouse (Mus musculus), Rat , we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens)
Tested applications: WB
Recommended dilutions: 1-0, 5ug/ml, Western blot: 0
Notes: Optimal dilution of the PLN antibody should be determined by the researcher
Intented use: This PLN antibodyis to be used only for research purposes and not for diagnostics
Uniprot #: P26678
Purity: Antigen affinity
Description: Comparison of the human to other mammalian phospholamban genes indicated a marked conservation of sequence for at least 217 bp upstream of the transcription start site, It is observed that human ventricle and quadriceps displayed high levels of phospholamban transcripts and proteins, Phospholamban is also expressed in slow-twitch skeletal muscle and some smooth muscle cells, The structure of the human phospholamban gene closely resembles that reported for chicken, The subsequent activation of the Ca(2+) pump leads to enhanced muscle relaxation rates, and mouse, rabbit, rat, thereby contributing to the inotropic response elicited in heart by beta-agonists, while the right atrium also expressed low levels of phospholamban, with markedly lower expression observed in smooth muscles, Phospholamban is a 52 amino acid integral membrane protein that regulates the Ca2+ pump in cardiac muscle and skeletal muscle cells
Immunogen: Amino acids MEKVQYLTRSAIRRASTIEMPQQARQKLQNLFINF of human PLN were used as the immunogen for the PLN antibody
Storage: Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the PLN antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term
Properties: C, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24°
Gene target: Phospholamban / PLN
Short name: Phospholamban Antibody / PLN
Technique: antibodies against human proteins, antibodies for, Antibody
Alternative name: Phospholamban (Antibody to) / PLN
Alternative technique: antibodies
Identity: 9080
Gene: PLN | More about : PLN
Long gene name: phospholamban
Synonyms gene: PLB
Synonyms: CMD1P
Locus: 6q22, 31
Discovery year: 1991-08-22
Entrez gene record: 5350
Pubmed identfication: 1828805
RefSeq identity: NM_002667
Havana BLAST/BLAT: OTTHUMG00000015462
Locus Specific Databases: LRG_390

Related Products :

MBS422429 Goat anti-Phospholamban / PLN Antibody 100ug 370 € MBS Polyclonals_1 human
MBS247330 Goat Polyclonal to Human PLN / Phospholamban Antibody 50ug 597 € MBS Polyclonals_1 human
F51974-0.08ML Phospholamban Antibody / PLN 0.08 ml 199 € NJS poly human
F51974-0.4ML Phospholamban Antibody / PLN 0.4 ml 406 € NJS poly human
R30366 Phospholamban Antibody / PLN 0.1mg 389 € NJS poly human
R32038 Phospholamban Antibody / PLN 0.1mg 406 € NJS poly human
R34687-100UG Phospholamban Antibody / PLN 0.1mg 406 € NJS poly human
abx570840 Anti-Mouse Phospholamban (PLN) ELISA Kit inquire 50 € abbex mouse
GENTAUR-58ba26e536817 Bovine Cardiac phospholamban (PLN) 1000ug 1194 € MBS Recombinant Proteins bovine
GENTAUR-58ba26e75937b Bovine Cardiac phospholamban (PLN) 1000ug 1702 € MBS Recombinant Proteins bovine
AE26956MO-48 ELISA test for Mouse Cardiac phospholamban (PLN) 1x plate of 48 wells 373 € abebio mouse
AE58049RB-48 ELISA test for Rabbit Cardiac phospholamban (PLN) 1x plate of 48 wells 402 € abebio human
AE26956MO-96 Mouse Cardiac phospholamban (PLN) ELISA Kit 1x plate of 96 wells 612 € abebio mouse
DL-PLN-Mu Mouse Phospholamban PLN ELISA Kit 96T 904 € DL elisas mouse
EKU06608 Phospholamban (PLN) ELISA kit 1 plate of 96 wells 804 € Biomatik ELISA kits human
AE58049RB Rabbit Cardiac phospholamban (PLN) ELISA Kit 48 wells plate 500 € ab-elisa elisas human
AE58049RB-96 Rabbit Cardiac phospholamban (PLN) ELISA Kit 1x plate of 96 wells 671 € abebio human
GENTAUR-58bd09c39611b Rat Cardiac phospholamban (Pln) 1000ug 1194 € MBS Recombinant Proteins rat
GENTAUR-58bd09c3e4195 Rat Cardiac phospholamban (Pln) 1000ug 1702 € MBS Recombinant Proteins rat
abx217824 Anti-PLN Antibody 100 μg 311 € abbex human
abx904090 Anti-PLN siRNA 15 nmol 528 € abbex human
abx928972 Anti-PLN siRNA inquire 50 € abbex human
abx928973 Anti-PLN siRNA 30 nmol 717 € abbex human
LV266203 PLN Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV) 1.0 µg DNA 322 € ABM lentivectors human
GWB-5897F9 antibody to or anti- phospho-Phospholamban (Ser16) antibody 1 x 1 vial 1041 € genways human
B0550-1 anti-Phospholamban Antibody 50 Вµg 347 € acr human
B0550-2 anti-Phospholamban Antibody 0,1 mg 500 € acr human
BB-PA1309 anti-Phospholamban Antibody 0,1 mg 471 € acr human
abx128024 Anti-Phospholamban Antibody 100 μg 499 € abbex human
abx217823 Anti-Phospholamban Antibody inquire 50 € abbex human