| Category: |
Antibody |
| Concentration: |
2ml sterile DI water, 5mg/ml if reconstituted with 0 |
| Form: |
Antigen affinity purified |
| Conjugation: |
Unconjugated |
| Clone: |
Polyclonal antibody |
| Recognised antigen: |
YY1 |
| Host animal: |
Rabbit (Oryctolagus cuniculus) |
| Clonality: |
Polyclonal (rabbit origin) |
| Species reactivity: |
Due to limited knowledge and inability to test the antibody against all known species, Rat , we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens) |
| Tested applications: |
WB |
| Recommended dilutions: |
1-0, 5ug/ml, Western blot: 0 |
| Notes: |
Optimal dilution of the YY1 antibody should be determined by the researcher |
| Intented use: |
This YY1 antibodyis to be used only for research purposes and not for diagnostics |
| Uniprot #: |
P25490 |
| Purity: |
Antigen affinity |
| Description: |
The protein is involved in repressing and activating a diverse number of promoters, YY1 is a ubiquitously distributed transcription factor belonging to the GLI-Kruppel class of zinc finger proteins, YY1 may direct histone deacetylases and histone acetyltransferases to a promoter in order to activate or repress the promoter, thus implicating histone modification in the function of YY1, YY1 (Yin Yang 1) is a transcriptional repressor protein in humans that is encoded by the YY1 gene |
| Immunogen: |
Amino acids EQKQVQIKTLEGEFSVTMWSSDEKKDIDHETVVEEQ of human YY1 were used as the immunogen for the YY1 antibody |
| Storage: |
Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the YY1 antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term |
| Localization: |
Nuclear |
| Properties: |
C, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24° |
| Gene target: |
YY1 |
| Short name: |
YY1 Antibody |
| Technique: |
antibodies against human proteins, antibodies for, Antibody |
| Alternative name: |
YY1 (Antibody to) |
| Alternative technique: |
antibodies |
| Identity: |
12856 |
| Gene: |
YY1 |
More about : YY1 |
| Long gene name: |
YY1 transcription factor |
| Synonyms: |
NF-E1 DELTA UCRBP YIN-YANG-1 INO80S |
| Synonyms name: |
INO80 complex subunit S Yin and Yang 1 protein |
| Locus: |
14q32, 2 |
| Discovery year: |
1993-09-17 |
| GenBank acession: |
BC020324 |
| Entrez gene record: |
7528 |
| Pubmed identfication: |
1655281 7912122 |
| RefSeq identity: |
NM_003403 |
| Classification: |
INO80 complex Zinc fingers C2H2-type |
| Havana BLAST/BLAT: |
OTTHUMG00000150479 |