YY1 Antibody

Contact us
Catalog number: R32034
Price: 406 €
Supplier: NJS poly
Product name: YY1 Antibody
Quantity: 0.1mg
Other quantities: 0.08 ml 199€ 0.1ml 263€ 0.4 ml 406€ 1 tube 486€ 1 x 1 vial 486€ 100ug 370€ 100ul 426€
Related search:

More details :

Category: Antibody
Concentration: 2ml sterile DI water, 5mg/ml if reconstituted with 0
Form: Antigen affinity purified
Conjugation: Unconjugated
Clone: Polyclonal antibody
Recognised antigen: YY1
Host animal: Rabbit (Oryctolagus cuniculus)
Clonality: Polyclonal (rabbit origin)
Species reactivity: Due to limited knowledge and inability to test the antibody against all known species, Rat , we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens)
Tested applications: WB
Recommended dilutions: 1-0, 5ug/ml, Western blot: 0
Notes: Optimal dilution of the YY1 antibody should be determined by the researcher
Intented use: This YY1 antibodyis to be used only for research purposes and not for diagnostics
Uniprot #: P25490
Purity: Antigen affinity
Description: The protein is involved in repressing and activating a diverse number of promoters, YY1 is a ubiquitously distributed transcription factor belonging to the GLI-Kruppel class of zinc finger proteins, YY1 may direct histone deacetylases and histone acetyltransferases to a promoter in order to activate or repress the promoter, thus implicating histone modification in the function of YY1, YY1 (Yin Yang 1) is a transcriptional repressor protein in humans that is encoded by the YY1 gene
Immunogen: Amino acids EQKQVQIKTLEGEFSVTMWSSDEKKDIDHETVVEEQ of human YY1 were used as the immunogen for the YY1 antibody
Storage: Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the YY1 antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term
Localization: Nuclear
Properties: C, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24°
Gene target: YY1
Short name: YY1 Antibody
Technique: antibodies against human proteins, antibodies for, Antibody
Alternative name: YY1 (Antibody to)
Alternative technique: antibodies
Identity: 12856
Gene: YY1 | More about : YY1
Long gene name: YY1 transcription factor
Synonyms: NF-E1 DELTA UCRBP YIN-YANG-1 INO80S
Synonyms name: INO80 complex subunit S Yin and Yang 1 protein
Locus: 14q32, 2
Discovery year: 1993-09-17
GenBank acession: BC020324
Entrez gene record: 7528
Pubmed identfication: 1655281 7912122
RefSeq identity: NM_003403
Classification: INO80 complex Zinc fingers C2H2-type
Havana BLAST/BLAT: OTTHUMG00000150479

Related Products :

abx571600 Anti-Human YY1 Transcription Factor (YY1) ELISA Kit 96 tests 789 € abbex human
MBS280062 Anti-Human YY1 Transcription Factor (YY1) PAb 100ug 536 € MBS Polyclonals_1 human
AE10842HU-48 ELISA test for Human Transcriptional repressor protein YY1 (YY1) 1x plate of 48 wells 373 € abebio human
AE10842HU Human Transcriptional repressor protein YY1 (YY1) ELISA Kit 48 wells plate 480 € ab-elisa elisas human
AE10842HU-96 Human Transcriptional repressor protein YY1 (YY1) ELISA Kit 1x plate of 96 wells 612 € abebio human
DL-YY1-Hu Human YY1 Transcription Factor YY1 ELISA Kit 96T 904 € DL elisas human
EKU08249 YY1 Transcription Factor (YY1) ELISA kit 1 plate of 96 wells 822 € Biomatik ELISA kits human
GWB-50B6AA RING1 And YY1 Binding protein (DEDAF) (RYBP) Rabbit antibody to or anti-Human Polyclonal (aa215-228) antibody 1 x 1 vial 602 € genways human
AR51675PU-N anti-YY1 (1-414, His-tag) Antibody 0,5 mg 1413 € acr human
AR51675PU-S anti-YY1 (1-414, His-tag) Antibody 0,1 mg 587 € acr human
AM31012PU-N anti-YY1 (221-321) Antibody 50 Вµg 819 € acr human
AM31010PU-N anti-YY1 Antibody 50 Вµg 819 € acr human
AM31011PU-N anti-YY1 Antibody 50 Вµg 819 € acr human
abx219396 Anti-YY1 Antibody inquire 50 € abbex human
AP12240PU-N anti-YY1 (Center) Antibody 0,4 ml 587 € acr human
GENTAUR-58bde74810ea1 Mouse Monoclonal [clone 2C4] (IgG1,k) to Human YY1 Antibody 50ug 663 € MBS mono human
GENTAUR-58bde67e5f20f Mouse Monoclonal [clone 4A5] (IgG1,k) to Human YY1 Antibody 50ug 663 € MBS mono human
GENTAUR-58bde6e6152a6 Mouse Monoclonal [clone 4D2] (IgG1,k) to Human YY1 Antibody 50ug 663 € MBS mono human
bsm-51412M YY1 (1183CT6.5.23.6) Monoclonal Antibody 0.1ml 211 € Bioss Primary Unconjugated Antibodies human
F47256-0.08ML YY1 Antibody 0.08 ml 199 € NJS poly human
F47256-0.4ML YY1 Antibody 0.4 ml 406 € NJS poly human
F48078-0.08ML YY1 Antibody 0.08 ml 199 € NJS poly human
F48078-0.4ML YY1 Antibody 0.4 ml 406 € NJS poly human
GWB-243FE5 YY1 antibody 1 x 1 vial 486 € genways human
GWB-655B99 YY1 antibody 1 tube 486 € genways human
GWB-75C8C7 YY1 antibody 1 tube 486 € genways human
MBS270537 YY1 antibody 100ul 426 € MBS Polyclonals_1 human
MBS272552 YY1 antibody 100ul 426 € MBS Polyclonals_1 human
MBS852570 YY1 Antibody 100ug 370 € MBS Polyclonals_1 human
R32034 YY1 Antibody 0.1mg 406 € NJS poly human