EIF2AK2 Antibody / PRKR / PKR

Contact us
Catalog number: R31995
Price: 282 €
Supplier: acr
Product name: EIF2AK2 Antibody / PRKR / PKR
Quantity: 50 Вµg
Related search:

More details :

Category: Antibody
Concentration: 2ml sterile DI water, 5mg/ml if reconstituted with 0
Form: Antigen affinity purified
Conjugation: Unconjugated
Clone: Polyclonal antibody
Recognised antigen: EIF2AK2 / PRKR / PKR
Host animal: Rabbit (Oryctolagus cuniculus)
Clonality: Polyclonal (rabbit origin)
Species reactivity: Due to limited knowledge and inability to test the antibody against all known species, we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens)
Tested applications: WB
Recommended dilutions: 1-0, 5ug/ml, Western blot: 0
Notes: Optimal dilution of the PKR antibody should be determined by the researcher
Intented use: This PKR antibodyis to be used only for research purposes and not for diagnostics
Uniprot #: P19525
Purity: Antigen affinity
Description: (1993) assigned the EIF2AK2 gene to the boundary between chromosome 2p22-p21, (1999) studied the mechanism underlying the resistance of hepatitis C virus (HCV) to interferon, (2002) showed that human gamma-interferon mRNA uses local activation of PKR in the cell to control its own translation yield, Activation of EIF2AK2 allows the kinase to phosphorylate its natural substrate, Ben-Asouli et al, By FISH analysis, E2 inhibited the kinase activity of PKR and blocked its inhibitory effect on protein synthesis and cell growth, IFNG mRNA was found to activate PKR through a pseudoknot in its 5-prime untranslated region, Squire et al, Taylor et al, They demonstrated that the HCV envelope protein E2 contains a sequence identical with phosphorylation sites of the interferon-inducible protein kinase PKR and the translation initiation factor EIF2-alpha, a target of PKR, also called PKR, is an enzyme that in humans is encoded by the EIF2AK2 gene, leading to the inhibition of protein synthesis, the alpha subunit of eukaryotic protein synthesis initiation factor-2, EIF2AK2 (Eukaryotic Translation Initiation Factor 2-Alpha Kinase 2)
Immunogen: Amino acids EKTLLQKLLSKKPEDRPNTSEILRTLTVWKKSPEKNERHTC of human PKR were used as the immunogen for the PKR antibody
Storage: Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the PKR antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term
Localization: Cytoplasmic
Properties: C, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24°
Gene target: EIF2AK2 / PRKR / PKR
Short name: EIF2AK2 Antibody / PRKR / PKR
Technique: antibodies against human proteins, antibodies for, Antibody
Alternative name: eukaryotic translation initiation factor 2-a phosphorylation catalyst 2 (Antibody to) / PRKR / PKR
Alternative technique: antibodies
Alternative to gene target: DNA-templated and biological process this GO :0006412 and translation and biological process this GO :0006468 and protein phosphorylation and biological process this GO :0008285 and negative regulation of cell proliferation and biological process this GO :0008601 and protein phosphatase type 2A regulator activity and molecular function this GO :0009615 and response to virus and biological process this GO :0016020 and membrane and cellular component this GO :0016772 and transferase activity, EIF2AK1 and PKR and PPP1R83 and PRKR, EIF2AK2 and IDBG-44867 and ENSG00000055332 and 5610, EIF2AK2 and IDBG-632472 and ENSBTAG00000008703 and 347700, Eif2ak2 and IDBG-199014 and ENSMUSG00000024079 and 19106, nuclei, this GO :0000186 and activation of MAPKK activity and biological process this GO :0001819 and positive regulation of cytokine production and biological process this GO :0003725 and double-stranded RNA binding and molecular function this GO :0004672 and protein kinase activity and molecular function this GO :0004674 and protein serine/threonine kinase activity and molecular function this GO :0004694 and eukaryotic translation initiation factor 2alpha kinase activity and molecular function this GO :0004713 and protein tyrosine kinase activity and molecular function this GO :0004715 and non-membrane spanning protein tyrosine kinase activity and molecular function this GO :0005515 and protein binding and molecular function this GO :0005524 and ATP binding and molecular function this GO :0005634 and nucleus and cellular component this GO :0005737 and cytoplasm and cellular component this GO :0005829 and cytosol and cellular component this GO :0006351 and transcription, this GO :0003725 : double-stranded RNA binding, this GO :0003725 : double-stranded RNA binding and also this GO :0004672 : protein kinase activity and also this GO :0004674 : protein serine/threonine kinase activity and also this GO :0004694 : eukaryotic translation initiation factor 2alpha kinase activity and also this GO :0004713 : protein tyrosine kinase activity and also this GO :0004715 : non-membrane spanning protein tyrosine kinase activity and also this GO :0005515 : protein binding and also this GO :0005524 : ATP binding and also this GO :0008601 : protein phosphatase type 2A regulator activity and also this GO :0016772 : transferase activity, this GO :0004672 : protein kinase activity, this GO :0004674 : protein serine/threonine kinase activity, this GO :0004694 : eukaryotic translation initiation factor 2alpha kinase activity, this GO :0004713 : protein tyrosine kinase activity, this GO :0004715 : non-membrane spanning protein tyrosine kinase activity, this GO :0005515 : protein binding, this GO :0005524 : ATP binding, this GO :0008601 : protein phosphatase type 2A regulator activity, this GO :0016772 : transferase activity, this GO :0044822 : poly(A) RNA binding, transferase activity, transferring phosphorus-containing groups, transferring phosphorus-containing groups and also this GO :0044822 : poly(A) RNA binding, transferring phosphorus-containing groups and molecular function this GO :0017148 and negative regulation of translation and biological process this GO :0018108 and peptidyl-tyrosine phosphorylation and biological process this GO :0019048 and modulation by virus of host morphology or physiology and biological process this GO :0019054 and modulation by virus of host process and biological process this GO :0019058 and viral life cycle and biological process this GO :0030683 and evasion or tolerance by virus of host immune response and biological process this GO :0030968 and endoplasmic reticulum unfolded protein response and biological process this GO :0032722 and positive regulation of chemokine production and biological process this GO :0032874 and positive regulation of stress-activated MAPK cascade and biological process this GO :0033689 and negative regulation of osteoblast proliferation and biological process this GO :0035455 and response to interferon-alpha and biological process this GO :0043066 and negative regulation of apoptotic process and biological process this GO :0044822 and poly(A) RNA binding and molecular function this GO :0045071 and negative regulation of viral genome replication and biological process this GO :0045087 and innate immune response and biological process this GO :0046777 and protein autophosphorylation and biological process this GO :0048471 and perinuclear region of cytoplasm and cellular component this GO :0051092 and positive regulation of NF-kappaB transcription factor activity and biological process this GO :0051607 and defense response to virus and biological process this GO :1900225 and regulation of NLRP3 inflammasome complex assembly and biological process this GO :1901224 and positive regulation of NIK/NF-kappaB signaling and biological process this GO :1901532 and regulation of hematopoietic progenitor cell differentiation and biological process this GO :1902033 and regulation of hematopoietic stem cell proliferation and biological process this GO :1902036 and regulation of hematopoietic stem cell differentiation and biological process, eukaryotic translation initiation factor 2-alpha kinase 2
Identity: 9437
Gene: EIF2AK2 | More about : EIF2AK2
Long gene name: eukaryotic translation initiation factor 2 alpha kinase 2
Synonyms gene: PRKR
Synonyms gene name: interferon-inducible double stranded RNA dependent , protein kinase
Synonyms: PKR EIF2AK1 PPP1R83
Synonyms name: protein phosphatase 1, regulatory subunit 83
Locus: 2p22, 2
Discovery year: 1992-12-04
GenBank acession: BC057805
Entrez gene record: 5610
Pubmed identfication: 1351683
RefSeq identity: NM_002759
Classification: Protein phosphatase 1 regulatory subunits
Havana BLAST/BLAT: OTTHUMG00000100962

Related Products :

R31995 EIF2AK2 Antibody / PRKR / PKR 0.1mg 406 € NJS poly human
GWB-B9D672 Interferon-Induced Double-Stranded RNA-Activated protein Kinase (PRKR) (EIF2AK2) Rabbit antibody to or anti-Human Polyclonal (C- terminus) Antib 1 vial 602 € genways human
GWB-35E6A6 Interferon-Induced Double-Stranded RNA-Activated protein Kinase (PRKR) (EIF2AK2) Rabbit antibody to or anti-Human Polyclonal (N- terminus) Antib 1 x 1 vial 602 € genways human
MBS621563 Protein Kinase, Interferon-Inducible Double Stranded RNA-Activated Protein Kinase (PRKR, EC 2.7.11.1, EIF2AK1, EIF2AK2, MGC126524) Antibody 50ug 724 € MBS Polyclonals_1 human
F40174-0.08ML PKR Antibody (PRKR) 0.08 ml 199 € NJS poly human
F40175-0.08ML PKR Antibody (PRKR) 0.08 ml 199 € NJS poly human
R31134 PKR Antibody (PRKR) 0.1mg 389 € NJS poly human
AP02771PU-N anti-EIF2AK2 / PKR Antibody 0,1 ml 442 € acr human
AP02771PU-S anti-EIF2AK2 / PKR Antibody 50 Вµl 384 € acr human
AP02776PU-N anti-EIF2AK2 / PKR Antibody 0,1 ml 442 € acr human
AP02776PU-S anti-EIF2AK2 / PKR Antibody 50 Вµl 384 € acr human
AP07298PU-N anti-EIF2AK2 / PKR Antibody 50 Вµg 732 € acr human
AP20747PU-N anti-EIF2AK2 / PKR Antibody 0,1 mg 558 € acr human
AP20748PU-N anti-EIF2AK2 / PKR Antibody 0,1 mg 558 € acr human
B7198-1 anti-EIF2AK2 / PKR Antibody 50 Вµg 347 € acr human
B7198-2 anti-EIF2AK2 / PKR Antibody 0,1 mg 500 € acr human
B7199-1 anti-EIF2AK2 / PKR Antibody 50 Вµg 347 € acr human
B7199-2 anti-EIF2AK2 / PKR Antibody 0,1 mg 500 € acr human
B8174-1 anti-EIF2AK2 / PKR Antibody 50 Вµg 347 € acr human
B8174-2 anti-EIF2AK2 / PKR Antibody 0,1 mg 500 € acr human
BB-PA2025 anti-EIF2AK2 / PKR Antibody 0,1 mg 471 € acr human
CPA1952-100ul anti-EIF2AK2 / PKR Antibody 0,1 ml 442 € acr human
CPA1952-200ul anti-EIF2AK2 / PKR Antibody 0,2 ml 688 € acr human
CPA1952-30ul anti-EIF2AK2 / PKR Antibody 30 Вµl 326 € acr human
CPA4395-100ul anti-EIF2AK2 / PKR Antibody 0,1 ml 442 € acr human
CPA4395-200ul anti-EIF2AK2 / PKR Antibody 0,2 ml 688 € acr human
CPA4395-30ul anti-EIF2AK2 / PKR Antibody 30 Вµl 326 € acr human
AP07747PU-N anti-EIF2AK2 / PKR (C-term) Antibody 50 Вµg 732 € acr human
AP15148PU-N anti-EIF2AK2 / PKR (C-term) Antibody 0,4 ml 587 € acr human
AP30675CP-N anti-EIF2AK2 / PKR Control Peptide Antibody 50 Вµg 282 € acr human