| Category: |
Antibody |
| Concentration: |
2ml sterile DI water, 5mg/ml if reconstituted with 0 |
| Form: |
Antigen affinity purified |
| Conjugation: |
Unconjugated |
| Clone: |
Polyclonal antibody |
| Recognised antigen: |
EIF2AK2 / PRKR / PKR |
| Host animal: |
Rabbit (Oryctolagus cuniculus) |
| Clonality: |
Polyclonal (rabbit origin) |
| Species reactivity: |
Due to limited knowledge and inability to test the antibody against all known species, we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens) |
| Tested applications: |
WB |
| Recommended dilutions: |
1-0, 5ug/ml, Western blot: 0 |
| Notes: |
Optimal dilution of the PKR antibody should be determined by the researcher |
| Intented use: |
This PKR antibodyis to be used only for research purposes and not for diagnostics |
| Uniprot #: |
P19525 |
| Purity: |
Antigen affinity |
| Description: |
(1993) assigned the EIF2AK2 gene to the boundary between chromosome 2p22-p21, (1999) studied the mechanism underlying the resistance of hepatitis C virus (HCV) to interferon, (2002) showed that human gamma-interferon mRNA uses local activation of PKR in the cell to control its own translation yield, Activation of EIF2AK2 allows the kinase to phosphorylate its natural substrate, Ben-Asouli et al, By FISH analysis, E2 inhibited the kinase activity of PKR and blocked its inhibitory effect on protein synthesis and cell growth, IFNG mRNA was found to activate PKR through a pseudoknot in its 5-prime untranslated region, Squire et al, Taylor et al, They demonstrated that the HCV envelope protein E2 contains a sequence identical with phosphorylation sites of the interferon-inducible protein kinase PKR and the translation initiation factor EIF2-alpha, a target of PKR, also called PKR, is an enzyme that in humans is encoded by the EIF2AK2 gene, leading to the inhibition of protein synthesis, the alpha subunit of eukaryotic protein synthesis initiation factor-2, EIF2AK2 (Eukaryotic Translation Initiation Factor 2-Alpha Kinase 2) |
| Immunogen: |
Amino acids EKTLLQKLLSKKPEDRPNTSEILRTLTVWKKSPEKNERHTC of human PKR were used as the immunogen for the PKR antibody |
| Storage: |
Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the PKR antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term |
| Localization: |
Cytoplasmic |
| Properties: |
C, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24° |
| Gene target: |
EIF2AK2 / PRKR / PKR |
| Short name: |
EIF2AK2 Antibody / PRKR / PKR |
| Technique: |
antibodies against human proteins, antibodies for, Antibody |
| Alternative name: |
eukaryotic translation initiation factor 2-a phosphorylation catalyst 2 (Antibody to) / PRKR / PKR |
| Alternative technique: |
antibodies |
| Alternative to gene target: |
DNA-templated and biological process this GO :0006412 and translation and biological process this GO :0006468 and protein phosphorylation and biological process this GO :0008285 and negative regulation of cell proliferation and biological process this GO :0008601 and protein phosphatase type 2A regulator activity and molecular function this GO :0009615 and response to virus and biological process this GO :0016020 and membrane and cellular component this GO :0016772 and transferase activity, EIF2AK1 and PKR and PPP1R83 and PRKR, EIF2AK2 and IDBG-44867 and ENSG00000055332 and 5610, EIF2AK2 and IDBG-632472 and ENSBTAG00000008703 and 347700, Eif2ak2 and IDBG-199014 and ENSMUSG00000024079 and 19106, nuclei, this GO :0000186 and activation of MAPKK activity and biological process this GO :0001819 and positive regulation of cytokine production and biological process this GO :0003725 and double-stranded RNA binding and molecular function this GO :0004672 and protein kinase activity and molecular function this GO :0004674 and protein serine/threonine kinase activity and molecular function this GO :0004694 and eukaryotic translation initiation factor 2alpha kinase activity and molecular function this GO :0004713 and protein tyrosine kinase activity and molecular function this GO :0004715 and non-membrane spanning protein tyrosine kinase activity and molecular function this GO :0005515 and protein binding and molecular function this GO :0005524 and ATP binding and molecular function this GO :0005634 and nucleus and cellular component this GO :0005737 and cytoplasm and cellular component this GO :0005829 and cytosol and cellular component this GO :0006351 and transcription, this GO :0003725 : double-stranded RNA binding, this GO :0003725 : double-stranded RNA binding and also this GO :0004672 : protein kinase activity and also this GO :0004674 : protein serine/threonine kinase activity and also this GO :0004694 : eukaryotic translation initiation factor 2alpha kinase activity and also this GO :0004713 : protein tyrosine kinase activity and also this GO :0004715 : non-membrane spanning protein tyrosine kinase activity and also this GO :0005515 : protein binding and also this GO :0005524 : ATP binding and also this GO :0008601 : protein phosphatase type 2A regulator activity and also this GO :0016772 : transferase activity, this GO :0004672 : protein kinase activity, this GO :0004674 : protein serine/threonine kinase activity, this GO :0004694 : eukaryotic translation initiation factor 2alpha kinase activity, this GO :0004713 : protein tyrosine kinase activity, this GO :0004715 : non-membrane spanning protein tyrosine kinase activity, this GO :0005515 : protein binding, this GO :0005524 : ATP binding, this GO :0008601 : protein phosphatase type 2A regulator activity, this GO :0016772 : transferase activity, this GO :0044822 : poly(A) RNA binding, transferase activity, transferring phosphorus-containing groups, transferring phosphorus-containing groups and also this GO :0044822 : poly(A) RNA binding, transferring phosphorus-containing groups and molecular function this GO :0017148 and negative regulation of translation and biological process this GO :0018108 and peptidyl-tyrosine phosphorylation and biological process this GO :0019048 and modulation by virus of host morphology or physiology and biological process this GO :0019054 and modulation by virus of host process and biological process this GO :0019058 and viral life cycle and biological process this GO :0030683 and evasion or tolerance by virus of host immune response and biological process this GO :0030968 and endoplasmic reticulum unfolded protein response and biological process this GO :0032722 and positive regulation of chemokine production and biological process this GO :0032874 and positive regulation of stress-activated MAPK cascade and biological process this GO :0033689 and negative regulation of osteoblast proliferation and biological process this GO :0035455 and response to interferon-alpha and biological process this GO :0043066 and negative regulation of apoptotic process and biological process this GO :0044822 and poly(A) RNA binding and molecular function this GO :0045071 and negative regulation of viral genome replication and biological process this GO :0045087 and innate immune response and biological process this GO :0046777 and protein autophosphorylation and biological process this GO :0048471 and perinuclear region of cytoplasm and cellular component this GO :0051092 and positive regulation of NF-kappaB transcription factor activity and biological process this GO :0051607 and defense response to virus and biological process this GO :1900225 and regulation of NLRP3 inflammasome complex assembly and biological process this GO :1901224 and positive regulation of NIK/NF-kappaB signaling and biological process this GO :1901532 and regulation of hematopoietic progenitor cell differentiation and biological process this GO :1902033 and regulation of hematopoietic stem cell proliferation and biological process this GO :1902036 and regulation of hematopoietic stem cell differentiation and biological process, eukaryotic translation initiation factor 2-alpha kinase 2 |
| Identity: |
9437 |
| Gene: |
EIF2AK2 |
More about : EIF2AK2 |
| Long gene name: |
eukaryotic translation initiation factor 2 alpha kinase 2 |
| Synonyms gene: |
PRKR |
| Synonyms gene name: |
interferon-inducible double stranded RNA dependent , protein kinase |
| Synonyms: |
PKR EIF2AK1 PPP1R83 |
| Synonyms name: |
protein phosphatase 1, regulatory subunit 83 |
| Locus: |
2p22, 2 |
| Discovery year: |
1992-12-04 |
| GenBank acession: |
BC057805 |
| Entrez gene record: |
5610 |
| Pubmed identfication: |
1351683 |
| RefSeq identity: |
NM_002759 |
| Classification: |
Protein phosphatase 1 regulatory subunits |
| Havana BLAST/BLAT: |
OTTHUMG00000100962 |