POR Antibody / CYPOR / Cytochrome P450 Oxidoreductase

Contact us
Catalog number: R31983
Price: 2857 €
Supplier: MBS Recombinant Proteins
Product name: POR Antibody / CYPOR / Cytochrome P450 Oxidoreductase
Quantity: 100ug
Related search:

More details :

Category: Antibody
Concentration: 2ml sterile DI water, 5mg/ml if reconstituted with 0
Form: Antigen affinity purified
Conjugation: Unconjugated
Clone: Polyclonal antibody
Recognised antigen: POR / CYPOR / Cytochrome P450 Oxidoreductase
Host animal: Rabbit (Oryctolagus cuniculus)
Clonality: Polyclonal (rabbit origin)
Species reactivity: Due to limited knowledge and inability to test the antibody against all known species, Mouse (Mus musculus), Rat , we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens)
Tested applications: IHC-P, WB
Recommended dilutions: 1-0, 5-1ug/ml, 5ug/ml, IHC (Paraffin): 0, Western blot: 0
Notes: Optimal dilution of the POR antibody should be determined by the researcher
Intented use: This POR antibodyis to be used only for research purposes and not for diagnostics
Uniprot #: P16435
Purity: Antigen affinity
Description: FAD and FMN, Mutations in this gene have been associated with various diseases, The gene encodes an endoplasmic reticulum membrane oxidoreductase with an FAD-binding domain and a flavodoxin-like domain, The protein binds two cofactors, amenorrhea and disordered steroidogenesis, congenital adrenal hyperplasia and Antley-Bixler syndrome, including apparent combined p450C17 and p450C21 deficiency, which allow it to donate electrons directly from NADPH to all microsomal p450 enzymes, POR is a membrane-bound enzyme required for electron transfer from NADPH to Cytochrome p450 in the endoplasmic reticulum of theeukaryotic cell
Immunogen: Amino acids RNMARDVQNTFYDIVAELGAMEHAQAVDYIKKLMTK of human Cytochrome P450 Oxidoreductase were used as the immunogen for the POR antibody
Storage: Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the POR antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term
Localization: membrane, Cytoplasmic
Properties: C, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24°
Gene target: POR / CYPOR / Cytochrome P450 Oxidoreductase
Short name: POR Antibody / CYPOR / Cytochrome P450 Oxidoreductase
Technique: antibodies against human proteins, antibodies for, Antibody
Alternative name: POR (Antibody to) / CYPOR / Cytochrome P450 Oxidoreductase
Alternative technique: antibodies
Identity: 3829
Gene: FRA10A | More about : FRA10A
Long gene name: folic acid type, fra(10)(q23, fragile site, rare, 2) , 3) or fra(10)(q24
Locus: 10q23, 2 , 3 or 10q24
Discovery year: 1986-01-01
Pubmed identfication: 15203205

Related Products :

R31983 POR Antibody / CYPOR / Cytochrome P450 Oxidoreductase 0.1mg 406 € NJS poly human
MBS624217 Cytochrome p450 2C9, ID (CYP2C9, (R)(S)-limonene 6-monooxygenase, (S)-limonene 6-monooxygenase, Cytochrome P450 PB-1, Cytochrome P450 MP-4, Cytochrome P450 MP-8, S-mephenytoin 4-hydroxylase) Antibody 200ul 603 € MBS Polyclonals_1 human
MBS242815 Goat Polyclonal to Human CYPOR / POR Antibody 50ug 597 € MBS Polyclonals_1 human
MBS624465 CYP3A5, ID (Cytochrome P450 3A5, CYPIIIA5, Cytochrome P450-PCN3, Cytochrome P450 HLp2) Antibody 200ul 603 € MBS Polyclonals_1 human
MBS610197 CYP17A1 (Cytochrome P450, family 17, subfamily A, polypeptide 1, HGNC:2593, CPT7, CYP17, P450C17, S17AH, cytochrome P450, family 17, cytochrome P450, subfamily XVII (steroid 17-alpha-hydroxylase), adrenal hyperplasia, cytochrome p450 XVIIA1, steroid 17-al Antibody 100ug 591 € MBS Polyclonals_1 human
MBS624279 CYP3A4, ID (Cytochrome P450 3A4, Quinine 3-monooxygenase, CYPIIIA4, Nifedipine Oxidase, Cytochrome P450 3A3, CYPIIIA3, Cytochrome P450 HLp, Taurochenodeoxycholate 6-alpha-hydroxylase, Cytochrome P450 NF-25, Cytochrome P450-PCN1, Albendazole Monooxygenase, Antibody 200ul 603 € MBS Polyclonals_1 human
MBS623447 CYP2A6 (Cytochrome P450 2A6, CYPIIA6, Coumarin 7-hydroxylase, Cytochrome P450 IIA3, Cytochrome P450(I), CYP2A3) Antibody 50ug 619 € MBS Polyclonals_1 human
GENTAUR-58bb5b0b2029f Rat NADPH--cytochrome P450 reductase (Por) 100ug 2840 € MBS Recombinant Proteins rat
GENTAUR-58bb5b0b6cd59 Rat NADPH--cytochrome P450 reductase (Por) 1000ug 2840 € MBS Recombinant Proteins rat
GENTAUR-58bb5b0bada0a Rat NADPH--cytochrome P450 reductase (Por) 100ug 3304 € MBS Recombinant Proteins rat
GENTAUR-58bb5b0c06b7e Rat NADPH--cytochrome P450 reductase (Por) 1000ug 3304 € MBS Recombinant Proteins rat
R31055 CYPOR Antibody 0.1mg 389 € NJS poly human
MBS422455 Goat anti-CYPOR Antibody 100ug 370 € MBS Polyclonals_1 human
MBS621960 Cyp2c23 (cytochrome P450, family 2, subfamily c, polypeptide 23, (Arachidonic acid epoxygenase, Cyp2c-23, CYPIIC23, Cytochrome P450 2C23) Antibody 5 Vials 658 € MBS Polyclonals_1 human
MBS624021 CYP24A1, CT (1,25-dihydroxyvitamin D(3) 24-hydroxylase, Mitochondrial, Vitamin D(3) 24-hydroxylase, 24-OHase, Cytochrome P450 24A1, Cytochrome P450-CC24, CYP24) Antibody 200ul 603 € MBS Polyclonals_1 human
MBS623395 CYP2C19, ID (Cytochrome P450 2C19, (R)-limonene 6-monooxygenase, (S)-limonene 6-monooxygenase, (S)-limonene 7-monooxygenase, CYPIIC19, Cytochrome P450-11A, Mephenytoin 4-hydroxylase, CYPIIC17, Cytochrome P450-254C) Antibody 200ul 603 € MBS Polyclonals_1 human
MBS621542 Cytochrome P450 19A1 (CYP19A1, ARO1, Aromatase, CPV1, CYAR, CYPXIX, EC 1.14.14.1, MGC104309, P-450AROM, cytochrome P450, family 19, Subfamily A, Polypeptide 1, ARO, AromataseN: Cytochrome P450, Family 19, Cytochrome P450, Subfamily XIX (aromatization of a Antibody 100ug 707 € MBS Polyclonals_1 human
MBS620444 Cytochrome P450 19A1 (Cytochrome P450 Family 19 Subfamily A Polypeptide 1, CYP19A1, CYP19, CYPXIX, Aromatase, ARO, ARO1, ARO 1, CPV, CYAR, Estrogen Synthetase, MGC104309, P450AROM, P-450AROM) Antibody 100ug 735 € MBS Polyclonals_1 human
MBS616366 Cytochrome P450 Aromatase (P450 Arom) Antibody 100ul 630 € MBS Polyclonals_1 human
GENTAUR-58b81aab90cec Gluconobacter oxydans Polyol:NADP oxidoreductase (por) 100ug 2343 € MBS Recombinant Proteins human
GENTAUR-58b81aabea8b8 Gluconobacter oxydans Polyol:NADP oxidoreductase (por) 1000ug 2343 € MBS Recombinant Proteins human
GENTAUR-58b81aac5cea0 Gluconobacter oxydans Polyol:NADP oxidoreductase (por) 100ug 2857 € MBS Recombinant Proteins human
GENTAUR-58b81aacb93d0 Gluconobacter oxydans Polyol:NADP oxidoreductase (por) 1000ug 2857 € MBS Recombinant Proteins human
GENTAUR-58b82bbb599bb Gluconobacter oxydans Polyol:NADP oxidoreductase (por) 100ug 2343 € MBS Recombinant Proteins human
GENTAUR-58b82bbbc9c45 Gluconobacter oxydans Polyol:NADP oxidoreductase (por) 1000ug 2343 € MBS Recombinant Proteins human
GENTAUR-58b82bbc78b27 Gluconobacter oxydans Polyol:NADP oxidoreductase (por) 100ug 2857 € MBS Recombinant Proteins human
GENTAUR-58b82bbd021f0 Gluconobacter oxydans Polyol:NADP oxidoreductase (por) 1000ug 2857 € MBS Recombinant Proteins human
GENTAUR-58b844307b97a Gluconobacter oxydans Polyol:NADP oxidoreductase (por) 100ug 2343 € MBS Recombinant Proteins human
GENTAUR-58b84430d735f Gluconobacter oxydans Polyol:NADP oxidoreductase (por) 1000ug 2343 € MBS Recombinant Proteins human
GENTAUR-58b844312c934 Gluconobacter oxydans Polyol:NADP oxidoreductase (por) 100ug 2857 € MBS Recombinant Proteins human