| Category: |
Antibody |
| Concentration: |
2ml sterile DI water, 5mg/ml if reconstituted with 0 |
| Form: |
Antigen affinity purified |
| Conjugation: |
Unconjugated |
| Clone: |
Polyclonal antibody |
| Recognised antigen: |
POR / CYPOR / Cytochrome P450 Oxidoreductase |
| Host animal: |
Rabbit (Oryctolagus cuniculus) |
| Clonality: |
Polyclonal (rabbit origin) |
| Species reactivity: |
Due to limited knowledge and inability to test the antibody against all known species, Mouse (Mus musculus), Rat , we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens) |
| Tested applications: |
IHC-P, WB |
| Recommended dilutions: |
1-0, 5-1ug/ml, 5ug/ml, IHC (Paraffin): 0, Western blot: 0 |
| Notes: |
Optimal dilution of the POR antibody should be determined by the researcher |
| Intented use: |
This POR antibodyis to be used only for research purposes and not for diagnostics |
| Uniprot #: |
P16435 |
| Purity: |
Antigen affinity |
| Description: |
FAD and FMN, Mutations in this gene have been associated with various diseases, The gene encodes an endoplasmic reticulum membrane oxidoreductase with an FAD-binding domain and a flavodoxin-like domain, The protein binds two cofactors, amenorrhea and disordered steroidogenesis, congenital adrenal hyperplasia and Antley-Bixler syndrome, including apparent combined p450C17 and p450C21 deficiency, which allow it to donate electrons directly from NADPH to all microsomal p450 enzymes, POR is a membrane-bound enzyme required for electron transfer from NADPH to Cytochrome p450 in the endoplasmic reticulum of theeukaryotic cell |
| Immunogen: |
Amino acids RNMARDVQNTFYDIVAELGAMEHAQAVDYIKKLMTK of human Cytochrome P450 Oxidoreductase were used as the immunogen for the POR antibody |
| Storage: |
Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the POR antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term |
| Localization: |
membrane, Cytoplasmic |
| Properties: |
C, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24° |
| Gene target: |
POR / CYPOR / Cytochrome P450 Oxidoreductase |
| Short name: |
POR Antibody / CYPOR / Cytochrome P450 Oxidoreductase |
| Technique: |
antibodies against human proteins, antibodies for, Antibody |
| Alternative name: |
POR (Antibody to) / CYPOR / Cytochrome P450 Oxidoreductase |
| Alternative technique: |
antibodies |
| Identity: |
3829 |
| Gene: |
FRA10A |
More about : FRA10A |
| Long gene name: |
folic acid type, fra(10)(q23, fragile site, rare, 2) , 3) or fra(10)(q24 |
| Locus: |
10q23, 2 , 3 or 10q24 |
| Discovery year: |
1986-01-01 |
| Pubmed identfication: |
15203205 |