| Category: |
Antibody |
| Concentration: |
2ml sterile DI water, 5mg/ml if reconstituted with 0 |
| Form: |
Antigen affinity purified |
| Conjugation: |
Unconjugated |
| Clone: |
Polyclonal antibody |
| Recognised antigen: |
LCAT |
| Host animal: |
Rabbit (Oryctolagus cuniculus) |
| Clonality: |
Polyclonal (rabbit origin) |
| Species reactivity: |
Due to limited knowledge and inability to test the antibody against all known species, Mouse (Mus musculus), Rat , we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens) |
| Tested applications: |
WB |
| Recommended dilutions: |
1-0, 5ug/ml, Western blot: 0 |
| Notes: |
Optimal dilution of the LCAT antibody should be determined by the researcher |
| Intented use: |
This LCAT antibodyis to be used only for research purposes and not for diagnostics |
| Uniprot #: |
P16301 |
| Purity: |
Antigen affinity |
| Description: |
(1987) used a cDNA clone corresponding to LCAT to assign the locus to 16q22 through the analysis of DNA from somatic cell hybrids and in situ hybridization, 2000), Azoulay et al, Cholesterol from peripheral cells is transferred to HDL particles, LCAT plays an important role in lipoprotein metabolism, The cholesterol ester is thereby transported to the liver (Jonas, and incorporated into the core of the lipoprotein, especially in the process termed 'reverse cholesterol transport, esterified through the action of LCAT on HDL, is an enzyme that converts free cholesterol into cholesteryl ester, ' The enzyme is synthesized in the liver and circulates in blood plasma as a complex with components of high density lipoprotein (HDL), LCAT (Lecithin: Cholesterol Acyltransferase) |
| Immunogen: |
Amino acids QPVHLLPMNETDHLNMVFSNKTLEHINAILLGAYR of mouse LCAT were used as the immunogen for the LCAT antibody |
| Storage: |
Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the LCAT antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term |
| Properties: |
C, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24° |
| Gene target: |
LCAT |
| Short name: |
LCAT Antibody |
| Technique: |
antibodies against human proteins, antibodies for, Antibody |
| Alternative name: |
LCAT (Antibody to) |
| Alternative technique: |
antibodies |
| Identity: |
6522 |
| Gene: |
LCAT |
More about : LCAT |
| Long gene name: |
lecithin-cholesterol acyltransferase |
| Synonyms name: |
phosphatidylcholine--sterol O-acyltransferase |
| Locus: |
16q22, 1 |
| Discovery year: |
2001-06-22 |
| Entrez gene record: |
3931 |
| Havana BLAST/BLAT: |
OTTHUMG00000137551 |