LCAT Antibody

Contact us
Catalog number: R31981
Price: 389 €
Supplier: NJS poly
Product name: LCAT Antibody
Quantity: 0.1mg
Other quantities: 0.1mg 389€ 0.1ml 263€ 1 vial 411€
Related search:

More details :

Category: Antibody
Concentration: 2ml sterile DI water, 5mg/ml if reconstituted with 0
Form: Antigen affinity purified
Conjugation: Unconjugated
Clone: Polyclonal antibody
Recognised antigen: LCAT
Host animal: Rabbit (Oryctolagus cuniculus)
Clonality: Polyclonal (rabbit origin)
Species reactivity: Due to limited knowledge and inability to test the antibody against all known species, Mouse (Mus musculus), Rat , we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens)
Tested applications: WB
Recommended dilutions: 1-0, 5ug/ml, Western blot: 0
Notes: Optimal dilution of the LCAT antibody should be determined by the researcher
Intented use: This LCAT antibodyis to be used only for research purposes and not for diagnostics
Uniprot #: P16301
Purity: Antigen affinity
Description: (1987) used a cDNA clone corresponding to LCAT to assign the locus to 16q22 through the analysis of DNA from somatic cell hybrids and in situ hybridization, 2000), Azoulay et al, Cholesterol from peripheral cells is transferred to HDL particles, LCAT plays an important role in lipoprotein metabolism, The cholesterol ester is thereby transported to the liver (Jonas, and incorporated into the core of the lipoprotein, especially in the process termed 'reverse cholesterol transport, esterified through the action of LCAT on HDL, is an enzyme that converts free cholesterol into cholesteryl ester, ' The enzyme is synthesized in the liver and circulates in blood plasma as a complex with components of high density lipoprotein (HDL), LCAT (Lecithin: Cholesterol Acyltransferase)
Immunogen: Amino acids QPVHLLPMNETDHLNMVFSNKTLEHINAILLGAYR of mouse LCAT were used as the immunogen for the LCAT antibody
Storage: Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the LCAT antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term
Properties: C, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24°
Gene target: LCAT
Short name: LCAT Antibody
Technique: antibodies against human proteins, antibodies for, Antibody
Alternative name: LCAT (Antibody to)
Alternative technique: antibodies
Identity: 6522
Gene: LCAT | More about : LCAT
Long gene name: lecithin-cholesterol acyltransferase
Synonyms name: phosphatidylcholine--sterol O-acyltransferase
Locus: 16q22, 1
Discovery year: 2001-06-22
Entrez gene record: 3931
Havana BLAST/BLAT: OTTHUMG00000137551

Related Products :

AR50723PU-N anti-LCAT (25-440, His-tag) Antibody 0,5 mg 1109 € acr human
AR50723PU-S anti-LCAT (25-440, His-tag) Antibody 0,1 mg 485 € acr human
BB-PA1967 anti-LCAT Antibody 0,1 mg 471 € acr human
GENTAUR-58be08bb064e6 Anti- LCAT Antibody 0.12 ml 348 € MBS Polyclonals human
GENTAUR-58be08bb7411f Anti- LCAT Antibody 0.06 ml 265 € MBS Polyclonals human
GENTAUR-58be3f5a7992b Anti- LCAT Antibody 100ug 393 € MBS Polyclonals human
abx216533 Anti-LCAT Antibody inquire 50 € abbex human
GENTAUR-58bdc140783be Anti- Lecithin Cholesterol Acyltransferase (LCAT) Antibody 50ug 398 € MBS Polyclonals human
GENTAUR-58bdc140d5e83 Anti- Lecithin Cholesterol Acyltransferase (LCAT) Antibody 100ug 525 € MBS Polyclonals human
GENTAUR-58bdc4462cea8 Anti- Lecithin Cholesterol Acyltransferase (LCAT) Antibody 100ug 542 € MBS Polyclonals human
GENTAUR-58bdc93d3dff0 Anti- Lecithin Cholesterol Acyltransferase (LCAT) Antibody 100ug 564 € MBS Polyclonals human
GENTAUR-58bdcbf6a2d8e Anti- Lecithin Cholesterol Acyltransferase (LCAT) Antibody 100ug 492 € MBS Polyclonals human
GENTAUR-58bdcbf88330c Anti- Lecithin Cholesterol Acyltransferase (LCAT) Antibody 50ug 376 € MBS Polyclonals human
GENTAUR-58bdce9aefcaa Anti- Lecithin Cholesterol Acyltransferase (LCAT) Antibody 100ug 503 € MBS Polyclonals human
GENTAUR-58bdce9bc76d1 Anti- Lecithin Cholesterol Acyltransferase (LCAT) Antibody 50ug 382 € MBS Polyclonals human
GENTAUR-58bdcedbde67a Anti- Lecithin Cholesterol Acyltransferase (LCAT) Antibody 100ug 503 € MBS Polyclonals human
GENTAUR-58bdcedc68085 Anti- Lecithin Cholesterol Acyltransferase (LCAT) Antibody 50ug 382 € MBS Polyclonals human
GENTAUR-58bdd10bbb0c1 Anti- Lecithin Cholesterol Acyltransferase (LCAT) Antibody 100ug 525 € MBS Polyclonals human
GENTAUR-58bdd10c24ff9 Anti- Lecithin Cholesterol Acyltransferase (LCAT) Antibody 50ug 398 € MBS Polyclonals human
GENTAUR-58bdd13607488 Anti- Lecithin Cholesterol Acyltransferase (LCAT) Antibody 100ug 531 € MBS Polyclonals human
GENTAUR-58bdd1d00343c Anti- Lecithin Cholesterol Acyltransferase (LCAT) Antibody 100ug 542 € MBS Polyclonals human
GENTAUR-58bdd20096d39 Anti- Lecithin Cholesterol Acyltransferase (LCAT) Antibody 100ug 564 € MBS Polyclonals human
GENTAUR-58bdd5cc1aea4 Anti- Lecithin Cholesterol Acyltransferase (LCAT) Antibody 100ug 564 € MBS Polyclonals human
GENTAUR-58bdd8dcade57 Anti- Lecithin Cholesterol Acyltransferase (LCAT) Antibody 100ug 603 € MBS Polyclonals human
GENTAUR-58bdd91c12d24 Anti- Lecithin Cholesterol Acyltransferase (LCAT) Antibody 100ug 603 € MBS Polyclonals human
GENTAUR-58bddc2165d55 Anti- Lecithin Cholesterol Acyltransferase (LCAT) Antibody 100ug 575 € MBS Polyclonals human
GENTAUR-58bddd170bfb8 Anti- Lecithin Cholesterol Acyltransferase (LCAT) Antibody 100ug 575 € MBS Polyclonals human
GWB-A795B2 LCAT antibody 1 vial 411 € genways human
GWB-MN917H LCAT antibody 1 vial 521 € genways human
R31073 LCAT Antibody 0.1mg 389 € NJS poly human