Platelet Derived Growth Factor Receptor alpha Antibody / PDGFRA

Contact us
Catalog number: R31979
Price: 278 €
Supplier: novo
Product name: Platelet Derived Growth Factor Receptor alpha Antibody / PDGFRA
Quantity: 50 µg
Related search:

More details :

Category: Antibody
Concentration: 2ml sterile DI water, 5mg/ml if reconstituted with 0
Form: Antigen affinity purified
Conjugation: Unconjugated
Clone: Polyclonal antibody
Recognised antigen: Platelet Derived Growth Factor Receptor alpha / PDGFRA
Host animal: Rabbit (Oryctolagus cuniculus)
Clonality: Polyclonal (rabbit origin)
Species reactivity: Due to limited knowledge and inability to test the antibody against all known species, Mouse (Mus musculus), Rat , we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens)
Tested applications: IHC-P, WB
Recommended dilutions: 1-0, 5-1ug/ml, 5ug/ml, IHC (Paraffin): 0, Western blot: 0
Notes: Optimal dilution of the PDGFR alpha antibody should be determined by the researcher
Intented use: This PDGFR alpha antibodyis to be used only for research purposes and not for diagnostics
Uniprot #: P16234
Purity: Antigen affinity
Description: And the PDGFRA gene contains 23 exons spanning about 65 kb, Joosten et al, Lei et al, PDGFRA is a critical receptor required for human CMV infection, PDGFRA is dramatically more capable of promoting PVR than is the closely related PDGFRB, PDGFRA is responsible for mediating cellular contraction of multiple growth factors: TGFB1 and members of the PDGF family, The PDGFA gene is mapped on 4q12, The PDGFRA-FIP1L1 gene is a constitutively activated tyrosine kinase that transforms hematopoietic cells and is a therapeutic target of imatinib, Using the human PDGFRA promoter linked to a luciferase reporter, alpha), also called PDGFR2 and CD140a, and thus a target for novel antiviral therapies, encodes a cell surface tyrosine kinase receptor for members of the platelet-derived growth factor family, noted that in the rabbit model of the disease, showed that PAX1 acts as a transcriptional activator of the PDGFRA gene in differentiated human embryonal carcinoma cells, PDGFRA (Platelet-derived growth factor receptor
Immunogen: Amino acids DFLKSDHPAVARMRVDSDNAYIGVTYKNEEDKLKD of human PDGFRA were used as the immunogen for the PDGFR alpha antibody
Storage: Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the PDGFR alpha antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term
Localization: membrane, Cytoplasmic
Properties: C, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24°
Gene target: Platelet Derived Growth Factor Receptor alpha / PDGFRA
Short name: Platelet Derived Growth Factor Receptor alpha Antibody / PDGFRA
Technique: antibodies against human proteins, antibodies for, Antibody
Alternative name: a polypeptide, Platelet Derived Growth Factor Receptor a (Antibody to) / platelet-derived growth factor receptor
Alternative technique: antibodies
Alternative to gene target: CD140A and PDGFR-2 and PDGFR2 and RHEPDGFRA, PDGFRA and IDBG-18854 and ENSG00000134853 and 5156, PDGFRA and IDBG-642308 and ENSBTAG00000007173 and 282301, Pdgfra and IDBG-171929 and ENSMUSG00000029231 and 18595, alpha polypeptide, nuclei, this GO :0001553 and luteinization and biological process this GO :0001701 and in utero embryonic development and biological process this GO :0001775 and cell activation and biological process this GO :0002244 and hematopoietic progenitor cell differentiation and biological process this GO :0004672 and protein kinase activity and molecular function this GO :0004713 and protein tyrosine kinase activity and molecular function this GO :0004714 and transmembrane receptor protein tyrosine kinase activity and molecular function this GO :0005018 and platelet-derived growth factor alpha-receptor activity and molecular function this GO :0005021 and vascular endothelial growth factor-activated receptor activity and molecular function this GO :0005161 and platelet-derived growth factor receptor binding and molecular function this GO :0005515 and protein binding and molecular function this GO :0005524 and ATP binding and molecular function this GO :0005634 and nucleus and cellular component this GO :0005737 and cytoplasm and cellular component this GO :0005886 and plasma membrane and cellular component this GO :0005887 and integral component of plasma membrane and cellular component this GO :0005902 and microvillus and cellular component this GO :0006468 and protein phosphorylation and biological process this GO :0007169 and transmembrane receptor protein tyrosine kinase signaling pathway and biological process this GO :0007173 and epidermal growth factor receptor signaling pathway and biological process this GO :0007204 and positive regulation of cytosolic calcium ion concentration and biological process this GO :0008210 and estrogen metabolic process and biological process this GO :0008284 and positive regulation of cell proliferation and biological process this GO :0008543 and fibroblast growth factor receptor signaling pathway and biological process this GO :0008585 and female this GO nad development and biological process this GO :0009653 and anatomical structure morphogenesis and biological process this GO :0009887 and organ morphogenesis and biological process this GO :0009897 and external side of plasma membrane and cellular component this GO :0009986 and cell surface and cellular component this GO :0010544 and negative regulation of platelet activation and biological process this GO :0010863 and positive regulation of phospholipase C activity and biological process this GO :0014068 and positive regulation of phosphatidylinositol 3-kinase signaling and biological process this GO :0016020 and membrane and cellular component this GO :0016021 and integral component of membrane and cellular component this GO :0016032 and viral process and biological process this GO :0016477 and cell migration and biological process this GO :0016772 and transferase activity, this GO :0004672 : protein kinase activity, this GO :0004672 : protein kinase activity and also this GO :0004713 : protein tyrosine kinase activity and also this GO :0004714 : transmembrane receptor protein tyrosine kinase activity and also this GO :0005018 : platelet-derived growth factor alpha-receptor activity and also this GO :0005021 : vascular endothelial growth factor-activated receptor activity and also this GO :0005161 : platelet-derived growth factor receptor binding and also this GO :0005515 : protein binding and also this GO :0005524 : ATP binding and also this GO :0016772 : transferase activity, this GO :0004713 : protein tyrosine kinase activity, this GO :0004714 : transmembrane receptor protein tyrosine kinase activity, this GO :0005018 : platelet-derived growth factor alpha-receptor activity, this GO :0005021 : vascular endothelial growth factor-activated receptor activity, this GO :0005161 : platelet-derived growth factor receptor binding, this GO :0005515 : protein binding, this GO :0005524 : ATP binding, this GO :0016772 : transferase activity, this GO :0038085 : vascular endothelial growth factor binding, this GO :0042803 : protein homodimerization activity, this GO :0048407 : platelet-derived growth factor binding, transferase activity, transferring phosphorus-containing groups, transferring phosphorus-containing groups and also this GO :0038085 : vascular endothelial growth factor binding and also this GO :0042803 : protein homodimerization activity and also this GO :0048407 : platelet-derived growth factor binding, transferring phosphorus-containing groups and molecular function this GO :0018108 and peptidyl-tyrosine phosphorylation and biological process this GO :0023019 and signal transduction involved in regulation of gene expression and biological process this GO :0030198 and extracellular matrix organization and biological process this GO :0030324 and lung development and biological process this GO :0030325 and adrenal gland development and biological process this GO :0030335 and positive regulation of cell migration and biological process this GO :0030539 and male genitalia development and biological process this GO :0031226 and intrinsic component of plasma membrane and cellular component this GO :0033327 and Leydig cell differentiation and biological process this GO :0035790 and platelet-derived growth factor receptor-alpha signaling pathway and biological process this GO :0038085 and vascular endothelial growth factor binding and molecular function this GO :0038091 and positive regulation of cell proliferation by VEGF-activated platelet derived growth factor receptor signaling pathway and biological process this GO :0038095 and Fc-epsilon receptor signaling pathway and biological process this GO :0042060 and wound healing and biological process this GO :0042475 and odontogenesis of dentin-containing tooth and biological process this GO :0042803 and protein homodimerization activity and molecular function this GO :0043552 and positive regulation of phosphatidylinositol 3-kinase activity and biological process this GO :0045087 and innate immune response and biological process this GO :0045740 and positive regulation of DNA replication and biological process this GO :0046777 and protein autophosphorylation and biological process this GO :0048008 and platelet-derived growth factor receptor signaling pathway and biological process this GO :0048011 and neurotrophin TRK receptor signaling pathway and biological process this GO :0048015 and phosphatidylinositol-mediated signaling and biological process this GO :0048146 and positive regulation of fibroblast proliferation and biological process this GO :0048407 and platelet-derived growth factor binding and molecular function this GO :0048557 and embryonic digestive tract morphogenesis and biological process this GO :0048701 and embryonic cranial skeleton morphogenesis and biological process this GO :0048704 and embryonic skeletal system morphogenesis and biological process this GO :0048705 and skeletal system morphogenesis and biological process this GO :0050920 and regulation of chemotaxis and biological process this GO :0055003 and cardiac myofibril assembly and biological process this GO :0060021 and palate development and biological process this GO :0060325 and face morphogenesis and biological process this GO :0060326 and cell chemotaxis and biological process this GO :0061298 and retina vasculature development in camera-type eye and biological process this GO :0070374 and positive regulation of ERK1 and ERK2 cascade and biological process this GO :0070527 and platelet aggregation and biological process this GO :0071230 and cellular response to amino acid stimulus and biological process this GO :0072277 and metanephric glomerular capillary formation and biological process this GO :2000249 and regulation of actin cytoskeleton reorganization and biological process this GO :2000739 and regulation of mesenchymal stem cell differentiation and biological process, platelet-derived growth factor receptor
Identity: 8803
Gene: PDGFRA | More about : PDGFRA
Long gene name: platelet derived growth factor receptor alpha
Synonyms gene name: alpha polypeptide , platelet-derived growth factor receptor
Synonyms: CD140a PDGFR2 GAS9
Locus: 4q12
Discovery year: 1989-05-19
GenBank acession: D50001
Entrez gene record: 5156
Pubmed identfication: 8643452
RefSeq identity: NM_006206
Classification: I-set domain containing CD molecules Receptor Tyrosine Kinases
Havana BLAST/BLAT: OTTHUMG00000128699
Locus Specific Databases: LRG_309

Related Products :

GWB-A0F44B Platelet-Derived Growth Factor Receptor Alpha (PDGFRA) Rabbit antibody to or anti-Human Polyclonal (aa1063-1077) antibody 1 vial 602 € genways human
GWB-BEFAA9 Platelet-Derived Growth Factor Receptor Alpha (PDGFRA) Rabbit antibody to or anti-Human Polyclonal (C- terminus) antibody 1 vial 602 € genways human
GWB-F21254 Platelet-Derived Growth Factor Receptor Alpha (PDGFRA) Rabbit antibody to or anti-Human Polyclonal (C- terminus) antibody 1 vial 602 € genways human
GWB-F9E8CA Platelet-Derived Growth Factor Receptor Alpha (PDGFRA) Rabbit antibody to or anti-Human Polyclonal (C- terminus) antibody 1 vial 648 € genways human
F43668-0.08ML Platelet Derived Growth Factor Receptor alpha Antibody (PDGFRA) 0.08 ml 199 € NJS poly human
F50654-0.08ML Platelet Derived Growth Factor Receptor alpha Antibody (PDGFRA) 0.08 ml 199 € NJS poly human
F50655-0.08ML Platelet Derived Growth Factor Receptor alpha Antibody (PDGFRA) 0.08 ml 199 € NJS poly human
F50656-0.08ML Platelet Derived Growth Factor Receptor alpha Antibody (PDGFRA) 0.08 ml 199 € NJS poly human
F50657-0.08ML Platelet Derived Growth Factor Receptor alpha Antibody (PDGFRA) 0.08 ml 199 € NJS poly human
F50658-0.08ML Platelet Derived Growth Factor Receptor alpha Antibody (PDGFRA) 0.08 ml 199 € NJS poly human
R31979 Platelet Derived Growth Factor Receptor alpha Antibody / PDGFRA 0.1mg 406 € NJS poly human
MBS623663 Platelet Derived Growth Factor Receptor alpha, phosphorylated (Tyr742) (PDGFRa) Antibody 10 Blots 663 € MBS Polyclonals_1 human
DL-PDGFRa-Hu Human Platelet Derived Growth Factor Receptor Alpha PDGFRa ELISA Kit 96T 846 € DL elisas human
EKU06691 Platelet Derived Growth Factor Receptor Alpha (PDGFRa) ELISA kit 1 plate of 96 wells 822 € Biomatik ELISA kits human
EKU06692 Platelet Derived Growth Factor Receptor Alpha (PDGFRa) ELISA kit 1 plate of 96 wells 888 € Biomatik ELISA kits human
DL-PDGFRa-Ra Rat Platelet Derived Growth Factor Receptor Alpha PDGFRa ELISA Kit 96T 869 € DL elisas rat
MBS611950 Nerve Growth Factor, beta (NGF, Beta Nerve Growth Factor, Beta Nerve Growth Factor Precursor, Beta NGF, HSAN5, Nerve Growth Factor beta, Nerve Growth Factor beta Polypeptide, Nerve Growth Factor beta Subunit, NGFB) 500ug 652 € MBS Polyclonals_1 human
AE28219HU-48 ELISA test for Human Platelet-Derived Growth Factor Soluble Receptor α (PDGFsR-α) 1x plate of 48 wells 352 € abebio human
AE28219HU-96 Human Platelet-Derived Growth Factor Soluble Receptor α (PDGFsR-α) ELISA Kit 1x plate of 96 wells 570 € abebio human
MBS623858 Integrin, beta3, CT (ITGB3, CD61, GP3A, GPIIIa, HPA-1, NAIT, Platelet Fibrinogen Receptor beta Subunit, Platelet Glycoprotein IIIa, Platelet Membrane Glycoprotein IIIa) Antibody 200ul 603 € MBS Polyclonals_1 human
MBS621028 Integrin, beta3 (ITGB3, CD61, GP3A, GPIIIa, HPA-1, NAIT, Platelet Fibrinogen Receptor beta Subunit, Platelet Glycoprotein IIIa, Platelet Membrane Glycoprotein IIIa) Antibody 50ug 928 € MBS Polyclonals_1 human
MBS624603 Integrin, beta3, phosphorylated (Tyr773) (Platelet Glycoprotein IIIa, CD61, GP3A, GPIIIa, ITGB3, NAIT, Platelet Fibrinogen Receptor beta Subunit, Platelet Membrane Glycoprotein IIIa) Antibody 50ug 481 € MBS Polyclonals_1 human
SP-101390-1 Platelet-Derived Growth Factor Receptor Substrate 1; PDGF Receptor Substrate (AA: Asn-pTyr-Ile-Ser-Lys-Gly-Ser-Thr-Phe-Leu) (MW: 1209.29) 1 mg 188 € adi human
abx253681 Anti-Human alpha type platelet-derived growth factor receptor ELISA Kit inquire 50 € abbex human
abx254332 Anti-Mouse Platelet-Derived Growth Factor Soluble Receptor alpha ELISA Kit 96 tests 557 € abbex mouse
abx166854 Anti-Platelet Derived Growth Factor Receptor alpha Protein (Recombinant) 100 μg 847 € abbex human
abx263243 Anti-Platelet-Derived Growth Factor Receptor, alpha Protein (Recombinant) 1 µg 238 € abbex human
abx255911 Anti-Rat Platelet-Derived Growth Factor Soluble Receptor alpha ELISA Kit inquire 50 € abbex rat
E-EL-Ch0290 Chicken PDGFRα (Platelet Derived Growth Factor Receptor Alpha) ELISA Kit 96T 568 € elabsciences human
C658 Recombinant Human Platelet-derived Growth Factor Receptor Alpha, PDGF Rα (C-6His) 50 µg 278 € novo human