c-Rel Antibody / REL

Contact us
Catalog number: R31972
Price: 348 €
Supplier: MBS Polyclonals
Product name: c-Rel Antibody / REL
Quantity: 0.12 ml
Related search:

More details :

Category: Antibody
Concentration: 2ml sterile DI water, 5mg/ml if reconstituted with 0
Form: Antigen affinity purified
Conjugation: Unconjugated
Clone: Polyclonal antibody
Recognised antigen: c-Rel / REL
Host animal: Rabbit (Oryctolagus cuniculus)
Clonality: Polyclonal (rabbit origin)
Species reactivity: Due to limited knowledge and inability to test the antibody against all known species, Mouse (Mus musculus), Rat , we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens)
Tested applications: IHC-P, WB
Recommended dilutions: 1-0, 5-1ug/ml, 5ug/ml, IHC (Paraffin): 0, Western blot: 0
Notes: Optimal dilution of the c-Rel antibody should be determined by the researcher
Intented use: This c-Rel antibodyis to be used only for research purposes and not for diagnostics
Uniprot #: P15307
Purity: Antigen affinity
Description: The REL gene is amplified or mutated in several human B-cell lymphomas, The c-Rel protein is a member of the NF-kB family of transcription factors and contains a Rel homology domain (RHD) at its N-terminus and two C-terminal transactivation domains, This gene is mapped to chromosome 2p13-p12, c-Rel has an important role in B-cell survival and proliferation, including diffuse large B-cell lymphoma and Hodgkin's lymphoma, The proto-oncogene c-Rel is a protein that in humans is encoded by the REL gene
Immunogen: Amino acids DQEVSESMDFRYLPDEKDAYGNKSKKQKTTLIFQKLLQD of mouse c-Rel were used as the immunogen for the c-Rel antibody
Storage: Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the c-Rel antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term
Localization: Cytoplasmic
Properties: C, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24°
Gene target: c-Rel / REL
Short name: c-Rel Antibody / REL
Technique: antibodies against human proteins, antibodies for, Antibody
Alternative name: c-v-rel reticuloendotheliosis viral oncogene homolog (avian) (Antibody to) / v-rel reticuloendotheliosis viral oncogene homolog (avian)
Alternative technique: antibodies
Alternative to gene target: C-Rel, DNA-templated and biological process this GO :0006355 and regulation of transcription, DNA-templated and biological process this GO :0007249 and I-kappaB kinase/NF-kappaB signaling and biological process this GO :0043123 and positive regulation of I-kappaB kinase/NF-kappaB signaling and biological process this GO :0043565 and sequence-specific DNA binding and molecular function this GO :0045084 and positive regulation of interleukin-12 biosynthetic process and biological process this GO :0045087 and innate immune response and biological process this GO :0045893 and positive regulation of transcription, DNA-templated and biological process this GO :0045944 and positive regulation of transcription from RNA polymerase II promoter and biological process this GO :1901215 and negative regulation of neuron death and biological process, REL and IDBG-53133 and ENSG00000162924 and 5966, REL and IDBG-634277 and ENSBTAG00000015386 and 509135, Rel and IDBG-155648 and ENSMUSG00000020275 and 19696, nuclei, sequence-specific DNA binding, this GO :0000980 and RNA polymerase II distal enhancer sequence-specific DNA binding and molecular function this GO :0001205 and RNA polymerase II distal enhancer sequence-specific DNA binding transcription factor activity involved in positive regulation of transcription and molecular function this GO :0001816 and cytokine production and biological process this GO :0003700 and sequence-specific DNA binding transcription factor activity and molecular function this GO :0005515 and protein binding and molecular function this GO :0005634 and nucleus and cellular component this GO :0005654 and nucleoplasm and cellular component this GO :0005667 and transcription factor complex and cellular component this GO :0005737 and cytoplasm and cellular component this GO :0005829 and cytosol and cellular component this GO :0006351 and transcription, this GO :0000980 : RNA polymerase II distal enhancer sequence-specific DNA binding, this GO :0000980 : RNA polymerase II distal enhancer sequence-specific DNA binding and also this GO :0001205 : RNA polymerase II distal enhancer sequence-specific DNA binding transcription factor activity involved in positive regulation of transcription and also this GO :0003700 : sequence-specific DNA binding transcription factor activity and also this GO :0005515 : protein binding and also this GO :0043565 : sequence-specific DNA binding, this GO :0001205 : RNA polymerase II distal enhancer sequence-specific DNA binding transcription factor activity involved in positive regulation of transcription, this GO :0003700 : sequence-specific DNA binding transcription factor activity, this GO :0005515 : protein binding, this GO :0043565 : sequence-specific DNA binding, v-rel reticuloendotheliosis viral oncogene homolog (avian)
Identity: 9954
Gene: REL | More about : REL
Long gene name: NF-kB subunit , REL proto-oncogene
Synonyms gene name: v-rel avian reticuloendotheliosis viral oncogene homolog
Synonyms: I-Rel c-Rel
Locus: 2p16, 1
Discovery year: 2001-06-22
GenBank acession: M11595
Entrez gene record: 5966
Pubmed identfication: 1577270
RefSeq identity: NM_002908
Classification: NF-kappa B complex subunits
Havana BLAST/BLAT: OTTHUMG00000129418

Related Products :

MBS247989 Anti-Human REL / C-Rel Antibody 0.05 ml 597 € MBS Polyclonals_1 human
R31972 c-Rel Antibody / REL 0.1mg 406 € NJS poly human
MBS244155 Goat Polyclonal to Human REL / C-Rel Antibody 50ug 597 € MBS Polyclonals_1 human
GENTAUR-58ba1d5de0932 Transforming protein rel polyprotein (V-REL) 1000ug 1111 € MBS Recombinant Proteins human
GENTAUR-58ba1d5e95d61 Transforming protein rel polyprotein (V-REL) 1000ug 1619 € MBS Recombinant Proteins human
GWB-29C3AC antibody to or anti-NFKB p65 (Rel A) antibody 1 x 1 vial 667 € genways human
GWB-34C0DE antibody to or anti- NFkB p65 (Rel A) antibody 1 x 1 vial 1030 € genways human
GWB-A41B9E antibody to or anti-NFKB p65 (Rel A) N-terminusINAL specificity antibody 1 vial 667 € genways human
GWB-750DDF antibody to or anti-NFKB p65 (Rel A) phospho specificity pS276 antibody 1 tube 667 € genways human
GWB-38A9CF antibody to or anti-NFKB p65 (Rel A) phospho specificity pS529 antibody 1 x 1 vial 667 € genways human
GWB-19C9B6 antibody to or anti-NFKB p65 (Rel A) phospho specificity pS536 antibody 1 x 1 vial 667 € genways human
GWB-6D1FB2 V-rel Reticuloendotheliosis Viral Oncogene Homolog A (RELA) Rabbit antibody to or anti-Human Polyclonal antibody 1 tube 602 € genways human
GWB-874176 V-rel Reticuloendotheliosis Viral Oncogene Homolog A (RELA) Rabbit antibody to or anti-Human Polyclonal (C- terminus) antibody 1 vial 602 € genways human
GWB-BA0CA6 V-rel Reticuloendotheliosis Viral Oncogene Homolog A (RELA) Rabbit antibody to or anti-Human Polyclonal (pSer276) antibody 1 vial 602 € genways human
GWB-13E0E8 V-rel Reticuloendotheliosis Viral Oncogene Homolog A (RELA) Rabbit antibody to or anti-Human Polyclonal (pSer529) antibody 1 x 1 vial 602 € genways human
GWB-743A1A V-rel Reticuloendotheliosis Viral Oncogene Homolog A (RELA) Rabbit antibody to or anti-Human Polyclonal (Ser536) antibody 1 tube 602 € genways human
abx133157 Anti-c-Rel (pS503) Antibody 100 μl 325 € abbex human
AP06306PU-N anti-REL Antibody 0,1 mg 558 € acr human
AP09497PU-N anti-REL Antibody 0,1 ml 442 € acr human
AP09497PU-S anti-REL Antibody 50 Вµl 384 € acr human
B7211-1 anti-REL Antibody 50 Вµg 347 € acr human
B7211-2 anti-REL Antibody 0,1 mg 500 € acr human
CPA1995-100ul anti-REL Antibody 0,1 ml 442 € acr human
CPA1995-200ul anti-REL Antibody 0,2 ml 688 € acr human
CPA1995-30ul anti-REL Antibody 30 Вµl 326 € acr human
GENTAUR-58bdf9a459962 Anti- REL Antibody 0.12 ml 348 € MBS Polyclonals human
GENTAUR-58bdf9a4cb750 Anti- REL Antibody 0.06 ml 265 € MBS Polyclonals human
GENTAUR-58bdfe2ac4800 Anti- REL Antibody 0.06 ml 265 € MBS Polyclonals human
GENTAUR-58bdfe2b3b306 Anti- REL Antibody 0.12 ml 348 € MBS Polyclonals human
GENTAUR-58be00a31641f Anti- REL Antibody 0.12 ml 348 € MBS Polyclonals human