| Category: |
Antibody |
| Concentration: |
2ml sterile DI water, 5mg/ml if reconstituted with 0 |
| Form: |
Antigen affinity purified |
| Conjugation: |
Unconjugated |
| Clone: |
Polyclonal antibody |
| Recognised antigen: |
c-Rel / REL |
| Host animal: |
Rabbit (Oryctolagus cuniculus) |
| Clonality: |
Polyclonal (rabbit origin) |
| Species reactivity: |
Due to limited knowledge and inability to test the antibody against all known species, Mouse (Mus musculus), Rat , we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens) |
| Tested applications: |
IHC-P, WB |
| Recommended dilutions: |
1-0, 5-1ug/ml, 5ug/ml, IHC (Paraffin): 0, Western blot: 0 |
| Notes: |
Optimal dilution of the c-Rel antibody should be determined by the researcher |
| Intented use: |
This c-Rel antibodyis to be used only for research purposes and not for diagnostics |
| Uniprot #: |
P15307 |
| Purity: |
Antigen affinity |
| Description: |
The REL gene is amplified or mutated in several human B-cell lymphomas, The c-Rel protein is a member of the NF-kB family of transcription factors and contains a Rel homology domain (RHD) at its N-terminus and two C-terminal transactivation domains, This gene is mapped to chromosome 2p13-p12, c-Rel has an important role in B-cell survival and proliferation, including diffuse large B-cell lymphoma and Hodgkin's lymphoma, The proto-oncogene c-Rel is a protein that in humans is encoded by the REL gene |
| Immunogen: |
Amino acids DQEVSESMDFRYLPDEKDAYGNKSKKQKTTLIFQKLLQD of mouse c-Rel were used as the immunogen for the c-Rel antibody |
| Storage: |
Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the c-Rel antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term |
| Localization: |
Cytoplasmic |
| Properties: |
C, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24° |
| Gene target: |
c-Rel / REL |
| Short name: |
c-Rel Antibody / REL |
| Technique: |
antibodies against human proteins, antibodies for, Antibody |
| Alternative name: |
c-v-rel reticuloendotheliosis viral oncogene homolog (avian) (Antibody to) / v-rel reticuloendotheliosis viral oncogene homolog (avian) |
| Alternative technique: |
antibodies |
| Alternative to gene target: |
C-Rel, DNA-templated and biological process this GO :0006355 and regulation of transcription, DNA-templated and biological process this GO :0007249 and I-kappaB kinase/NF-kappaB signaling and biological process this GO :0043123 and positive regulation of I-kappaB kinase/NF-kappaB signaling and biological process this GO :0043565 and sequence-specific DNA binding and molecular function this GO :0045084 and positive regulation of interleukin-12 biosynthetic process and biological process this GO :0045087 and innate immune response and biological process this GO :0045893 and positive regulation of transcription, DNA-templated and biological process this GO :0045944 and positive regulation of transcription from RNA polymerase II promoter and biological process this GO :1901215 and negative regulation of neuron death and biological process, REL and IDBG-53133 and ENSG00000162924 and 5966, REL and IDBG-634277 and ENSBTAG00000015386 and 509135, Rel and IDBG-155648 and ENSMUSG00000020275 and 19696, nuclei, sequence-specific DNA binding, this GO :0000980 and RNA polymerase II distal enhancer sequence-specific DNA binding and molecular function this GO :0001205 and RNA polymerase II distal enhancer sequence-specific DNA binding transcription factor activity involved in positive regulation of transcription and molecular function this GO :0001816 and cytokine production and biological process this GO :0003700 and sequence-specific DNA binding transcription factor activity and molecular function this GO :0005515 and protein binding and molecular function this GO :0005634 and nucleus and cellular component this GO :0005654 and nucleoplasm and cellular component this GO :0005667 and transcription factor complex and cellular component this GO :0005737 and cytoplasm and cellular component this GO :0005829 and cytosol and cellular component this GO :0006351 and transcription, this GO :0000980 : RNA polymerase II distal enhancer sequence-specific DNA binding, this GO :0000980 : RNA polymerase II distal enhancer sequence-specific DNA binding and also this GO :0001205 : RNA polymerase II distal enhancer sequence-specific DNA binding transcription factor activity involved in positive regulation of transcription and also this GO :0003700 : sequence-specific DNA binding transcription factor activity and also this GO :0005515 : protein binding and also this GO :0043565 : sequence-specific DNA binding, this GO :0001205 : RNA polymerase II distal enhancer sequence-specific DNA binding transcription factor activity involved in positive regulation of transcription, this GO :0003700 : sequence-specific DNA binding transcription factor activity, this GO :0005515 : protein binding, this GO :0043565 : sequence-specific DNA binding, v-rel reticuloendotheliosis viral oncogene homolog (avian) |
| Identity: |
9954 |
| Gene: |
REL |
More about : REL |
| Long gene name: |
NF-kB subunit , REL proto-oncogene |
| Synonyms gene name: |
v-rel avian reticuloendotheliosis viral oncogene homolog |
| Synonyms: |
I-Rel c-Rel |
| Locus: |
2p16, 1 |
| Discovery year: |
2001-06-22 |
| GenBank acession: |
M11595 |
| Entrez gene record: |
5966 |
| Pubmed identfication: |
1577270 |
| RefSeq identity: |
NM_002908 |
| Classification: |
NF-kappa B complex subunits |
| Havana BLAST/BLAT: |
OTTHUMG00000129418 |