IRF2 Antibody

Contact us
Catalog number: R31965
Price: 263 €
Supplier: Bioss Primary Unconjugated Antibodies
Product name: IRF2 Antibody
Quantity: 0.1ml
Other quantities: 0.08 ml 199€ 0.1mg 389€ 0.1ml 263€ 0.4 ml 406€ 1 vial 486€ 50ug 365€
Related search:

More details :

Category: Antibody
Concentration: 2ml sterile DI water, 5mg/ml if reconstituted with 0
Form: Antigen affinity purified
Conjugation: Unconjugated
Clone: Polyclonal antibody
Recognised antigen: IRF2
Host animal: Rabbit (Oryctolagus cuniculus)
Clonality: Polyclonal (rabbit origin)
Species reactivity: Due to limited knowledge and inability to test the antibody against all known species, Rat , we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens)
Tested applications: WB
Recommended dilutions: 1-0, 5ug/ml, Western blot: 0
Notes: Optimal dilution of the IRF2 antibody should be determined by the researcher
Intented use: This IRF2 antibodyis to be used only for research purposes and not for diagnostics
Uniprot #: P14316
Purity: Antigen affinity
Description: Also acts as an activator for several genes including H4 and IL7, Antagonizes IRF1 transcriptional activation, Constitutively binds to the ISRE promoter to activate IL7, Involved in cell cycle regulation through binding the site II (HiNF-M) promoter region of H4 and activating transcription during cell growth, [UniProt], Specifically binds to the upstream regulatory region of type I IFN and IFN-inducible MHC class I genes (the interferon consensus sequence (ICS)) and represses those genes
Immunogen: Amino acids MTPASSSSRPDRETRASVIKKTSDITQARVKS of human IRF2 were used as the immunogen for the IRF2 antibody
Storage: Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the IRF2 antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term
Properties: C, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24°
Gene target: IRF2
Short name: IRF2 Antibody
Technique: antibodies against human proteins, antibodies for, Antibody
Alternative name: interferon regulatory factor 2 (Antibody to)
Alternative technique: antibodies
Alternative to gene target: DNA-templated and biological process this GO :0006355 and regulation of transcription, DNA-templated and biological process this GO :0007596 and blood coagulation and biological process this GO :0008283 and cell proliferation and biological process this GO :0019221 and cytokine-mediated signaling pathway and biological process this GO :0045087 and innate immune response and biological process this GO :0060333 and interferon-gamma-mediated signaling pathway and biological process this GO :0060337 and type I interferon signaling pathway and biological process, IRF-2, IRF2 and IDBG-46310 and ENSG00000168310 and 3660, IRF2 and IDBG-628515 and ENSBTAG00000010002 and 337916, Irf2 and IDBG-154369 and ENSMUSG00000031627 and 16363, nuclei, protein binding, this GO :0000122 and negative regulation of transcription from RNA polymerase II promoter and biological process this GO :0000975 and regulatory region DNA binding and molecular function this GO :0003677 and DNA binding and molecular function this GO :0003700 and sequence-specific DNA binding transcription factor activity and molecular function this GO :0005515 and protein binding and molecular function this GO :0005654 and nucleoplasm and cellular component this GO :0005829 and cytosol and cellular component this GO :0006351 and transcription, this GO :0000975 : regulatory region DNA binding, this GO :0000975 : regulatory region DNA binding and also this GO :0003677 : DNA binding and also this GO :0003700 : sequence-specific DNA binding transcription factor activity and also this GO :0005515 : protein binding, this GO :0003677 : DNA binding, this GO :0003700 : sequence-specific DNA binding transcription factor activity, this GO :0005515 : protein binding, interferon regulatory factor 2
Identity: 6117
Gene: IRF2 | More about : IRF2
Long gene name: interferon regulatory factor 2
Locus: 4q35, 1
Discovery year: 1991-05-09
Entrez gene record: 3660
Pubmed identfication: 2475256
Havana BLAST/BLAT: OTTHUMG00000160606

Related Products :

AR09056PU-L anti-IRF2 (1-113, His-tag) Antibody 0,5 mg 1500 € acr human
AR09056PU-N anti-IRF2 (1-113, His-tag) Antibody 0,1 mg 587 € acr human
A03I0080 anti-IRF2 Antibody 200ug (50ug, 100ug available) 465 € Bluegen antibodies human
AP06668PU-N anti-IRF2 Antibody 0,1 mg 558 € acr human
BB-PA1818 anti-IRF2 Antibody 0,1 mg 471 € acr human
C10366-1 anti-IRF2 Antibody 50 Вµg 347 € acr human
C10366-2 anti-IRF2 Antibody 0,1 mg 500 € acr human
GENTAUR-58be0b9269103 Anti- IRF2 Antibody 0.06 ml 265 € MBS Polyclonals human
GENTAUR-58be0b92d66cc Anti- IRF2 Antibody 0.12 ml 348 € MBS Polyclonals human
GENTAUR-58be303172300 Anti- IRF2 Antibody 0.2 ml 603 € MBS Polyclonals human
GENTAUR-58be3e5e781c8 Anti- IRF2 Antibody 100ug 393 € MBS Polyclonals human
abx216304 Anti-IRF2 Antibody 200 μg 369 € abbex human
AP52235PU-N anti-IRF2 (Center) Antibody 0,4 ml 587 € acr human
MBS420193 Goat anti-IRF2 Antibody 100ug 370 € MBS Polyclonals_1 human
GWB-ASD404 Human IRF2 Antibody bulk Ask price € genways bulk human
F41303-0.08ML IRF2 Antibody 0.08 ml 199 € NJS poly human
F41303-0.4ML IRF2 Antibody 0.4 ml 406 € NJS poly human
GENTAUR-58be2b1921889 IRF2 antibody 50ug 365 € MBS mono human
GWB-85912A IRF2 antibody 1 vial 486 € genways human
GWB-F34C28 IRF2 antibody 1 vial 411 € genways human
R30916 IRF2 Antibody 0.1mg 389 € NJS poly human
R31965 IRF2 Antibody 0.1mg 406 € NJS poly human
R34678-100UG IRF2 Antibody 0.1mg 406 € NJS poly human
bs-16699R-A350 IRF2 Antibody, ALEXA FLUOR 350 100ul 332 € Bioss Primary Conjugated Antibodies. human
bs-16699R-A488 IRF2 Antibody, ALEXA FLUOR 488 100ul 332 € Bioss Primary Conjugated Antibodies. human
bs-16699R-A555 IRF2 Antibody, ALEXA FLUOR 555 100ul 332 € Bioss Primary Conjugated Antibodies. human
bs-16699R-A594 IRF2 Antibody, ALEXA FLUOR 594 100ul 332 € Bioss Primary Conjugated Antibodies. human
bs-16699R-A647 IRF2 Antibody, ALEXA FLUOR 647 100ul 332 € Bioss Primary Conjugated Antibodies. human
bs-16699R-Biotin IRF2 Antibody, Biotin Conjugated 0.1ml 333 € Bioss Primary Conjugated Antibodies human
bs-16699R IRF2 Antibody 0.1ml 263 € Bioss Primary Unconjugated Antibodies human