| Category: |
Antibody |
| Concentration: |
2ml sterile DI water, 5mg/ml if reconstituted with 0 |
| Form: |
Antigen affinity purified |
| Conjugation: |
Unconjugated |
| Clone: |
Polyclonal antibody |
| Recognised antigen: |
IRF2 |
| Host animal: |
Rabbit (Oryctolagus cuniculus) |
| Clonality: |
Polyclonal (rabbit origin) |
| Species reactivity: |
Due to limited knowledge and inability to test the antibody against all known species, Rat , we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens) |
| Tested applications: |
WB |
| Recommended dilutions: |
1-0, 5ug/ml, Western blot: 0 |
| Notes: |
Optimal dilution of the IRF2 antibody should be determined by the researcher |
| Intented use: |
This IRF2 antibodyis to be used only for research purposes and not for diagnostics |
| Uniprot #: |
P14316 |
| Purity: |
Antigen affinity |
| Description: |
Also acts as an activator for several genes including H4 and IL7, Antagonizes IRF1 transcriptional activation, Constitutively binds to the ISRE promoter to activate IL7, Involved in cell cycle regulation through binding the site II (HiNF-M) promoter region of H4 and activating transcription during cell growth, [UniProt], Specifically binds to the upstream regulatory region of type I IFN and IFN-inducible MHC class I genes (the interferon consensus sequence (ICS)) and represses those genes |
| Immunogen: |
Amino acids MTPASSSSRPDRETRASVIKKTSDITQARVKS of human IRF2 were used as the immunogen for the IRF2 antibody |
| Storage: |
Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the IRF2 antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term |
| Properties: |
C, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24° |
| Gene target: |
IRF2 |
| Short name: |
IRF2 Antibody |
| Technique: |
antibodies against human proteins, antibodies for, Antibody |
| Alternative name: |
interferon regulatory factor 2 (Antibody to) |
| Alternative technique: |
antibodies |
| Alternative to gene target: |
DNA-templated and biological process this GO :0006355 and regulation of transcription, DNA-templated and biological process this GO :0007596 and blood coagulation and biological process this GO :0008283 and cell proliferation and biological process this GO :0019221 and cytokine-mediated signaling pathway and biological process this GO :0045087 and innate immune response and biological process this GO :0060333 and interferon-gamma-mediated signaling pathway and biological process this GO :0060337 and type I interferon signaling pathway and biological process, IRF-2, IRF2 and IDBG-46310 and ENSG00000168310 and 3660, IRF2 and IDBG-628515 and ENSBTAG00000010002 and 337916, Irf2 and IDBG-154369 and ENSMUSG00000031627 and 16363, nuclei, protein binding, this GO :0000122 and negative regulation of transcription from RNA polymerase II promoter and biological process this GO :0000975 and regulatory region DNA binding and molecular function this GO :0003677 and DNA binding and molecular function this GO :0003700 and sequence-specific DNA binding transcription factor activity and molecular function this GO :0005515 and protein binding and molecular function this GO :0005654 and nucleoplasm and cellular component this GO :0005829 and cytosol and cellular component this GO :0006351 and transcription, this GO :0000975 : regulatory region DNA binding, this GO :0000975 : regulatory region DNA binding and also this GO :0003677 : DNA binding and also this GO :0003700 : sequence-specific DNA binding transcription factor activity and also this GO :0005515 : protein binding, this GO :0003677 : DNA binding, this GO :0003700 : sequence-specific DNA binding transcription factor activity, this GO :0005515 : protein binding, interferon regulatory factor 2 |
| Identity: |
6117 |
| Gene: |
IRF2 |
More about : IRF2 |
| Long gene name: |
interferon regulatory factor 2 |
| Locus: |
4q35, 1 |
| Discovery year: |
1991-05-09 |
| Entrez gene record: |
3660 |
| Pubmed identfication: |
2475256 |
| Havana BLAST/BLAT: |
OTTHUMG00000160606 |