| Category: |
Antibody |
| Concentration: |
2ml sterile DI water, 5mg/ml if reconstituted with 0 |
| Form: |
Antigen affinity purified |
| Conjugation: |
Unconjugated |
| Clone: |
Polyclonal antibody |
| Recognised antigen: |
MGST1 |
| Host animal: |
Rabbit (Oryctolagus cuniculus) |
| Clonality: |
Polyclonal (rabbit origin) |
| Species reactivity: |
Due to limited knowledge and inability to test the antibody against all known species, Mouse (Mus musculus), Rat , we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens) |
| Tested applications: |
WB |
| Recommended dilutions: |
1-0, 5ug/ml, Western blot: 0 |
| Notes: |
Optimal dilution of the MGST1 antibody should be determined by the researcher |
| Intented use: |
This MGST1 antibodyis to be used only for research purposes and not for diagnostics |
| Uniprot #: |
P10620 |
| Purity: |
Antigen affinity |
| Description: |
Other family members, Several transcript variants, The MAPEG (Membrane Associated Proteins in Eicosanoid and Glutathione metabolism) family consists of six human proteins, This gene encodes a protein that catalyzes the conjugation of glutathione to electrophiles and the reduction of lipid hydroperoxides, This protein is localized to the endoplasmic reticulum and outer mitochondrial membrane where it is thought to protect these membranes from oxidative stress, and pharmacologically active electrophilic compounds, are involved in cellular defense against toxic, carcinogenic, demonstrating glutathione S-transferase and peroxidase activities, have been found for this gene, important mediators of inflammation, some non-protein coding and some protein coding, two of which are involved in the production of leukotrienes and prostaglandin E, Microsomal glutathione S-transferase 1 is an enzyme that in humans is encoded by the MGST1 gene |
| Immunogen: |
Amino acids KVFANPEDCVAFGKGENAKKYLRTDDRVERVRRA of human MGST1 were used as the immunogen for the MGST1 antibody |
| Storage: |
Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the MGST1 antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term |
| Properties: |
C, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24° |
| Gene target: |
MGST1 |
| Short name: |
MGST1 Antibody |
| Technique: |
antibodies against human proteins, antibodies for, Antibody |
| Alternative name: |
microsomal glutathione S-transferase 1 (Antibody to) |
| Alternative technique: |
antibodies |
| Alternative to gene target: |
GST12 and MGST and MGST-I, MGST1 and IDBG-21764 and ENSG00000008394 and 4257, MGST1 and IDBG-639137 and ENSBTAG00000008541 and 493719, Mgst1 and IDBG-195593 and ENSMUSG00000008540 and 56615, glutathione binding, nuclei, this GO :0004364 and glutathione transferase activity and molecular function this GO :0004602 and glutathione peroxidase activity and molecular function this GO :0005515 and protein binding and molecular function this GO :0005634 and nucleus and cellular component this GO :0005739 and mitochondrion and cellular component this GO :0005741 and mitochondrial outer membrane and cellular component this GO :0005743 and mitochondrial inner membrane and cellular component this GO :0005778 and peroxisomal membrane and cellular component this GO :0005783 and endoplasmic reticulum and cellular component this GO :0005789 and endoplasmic reticulum membrane and cellular component this GO :0006749 and glutathione metabolic process and biological process this GO :0006805 and xenobiotic metabolic process and biological process this GO :0010243 and response to organonitrogen compound and biological process this GO :0016021 and integral component of membrane and cellular component this GO :0032496 and response to lipopolysaccharide and biological process this GO :0033327 and Leydig cell differentiation and biological process this GO :0042493 and response to drug and biological process this GO :0042802 and identical protein binding and molecular function this GO :0042803 and protein homodimerization activity and molecular function this GO :0043295 and glutathione binding and molecular function this GO :0044281 and small molecule metabolic process and biological process this GO :0045177 and apical part of cell and cellular component this GO :0055114 and oxidation-reduction process and biological process this GO :0070207 and protein homotrimerization and biological process this GO :0071449 and cellular response to lipid hydroperoxide and biological process this GO :1901687 and glutathione derivative biosynthetic process and biological process, this GO :0004364 : glutathione transferase activity, this GO :0004364 : glutathione transferase activity and also this GO :0004602 : glutathione peroxidase activity and also this GO :0005515 : protein binding and also this GO :0042802 : identical protein binding and also this GO :0042803 : protein homodimerization activity and also this GO :0043295 : glutathione binding, this GO :0004602 : glutathione peroxidase activity, this GO :0005515 : protein binding, this GO :0042802 : identical protein binding, this GO :0042803 : protein homodimerization activity, this GO :0043295 : glutathione binding, microsomal glutathione S-transferase 1 |
| Identity: |
7061 |
| Gene: |
MGST1 |
More about : MGST1 |
| Long gene name: |
microsomal glutathione S-transferase 1 |
| Synonyms gene: |
GST12 |
| Synonyms: |
MGST-I |
| Locus: |
12p12, 3 |
| Discovery year: |
1989-05-24 |
| GenBank acession: |
U46494 |
| Entrez gene record: |
4257 |
| RefSeq identity: |
NM_145791 |
| Classification: |
Glutathione S-transferases |
| Havana BLAST/BLAT: |
OTTHUMG00000168816 |