| Category: |
Antibody |
| Concentration: |
2ml sterile DI water, 5mg/ml if reconstituted with 0 |
| Form: |
Antigen affinity purified |
| Conjugation: |
Unconjugated |
| Clone: |
Polyclonal antibody |
| Recognised antigen: |
HSP90 beta / HSP90AB1 |
| Host animal: |
Rabbit (Oryctolagus cuniculus) |
| Clonality: |
Polyclonal (rabbit origin) |
| Species reactivity: |
Due to limited knowledge and inability to test the antibody against all known species, Mouse (Mus musculus), Rat , we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens) |
| Tested applications: |
IHC-P, WB |
| Recommended dilutions: |
1-0, 5-1ug/ml, 5ug/ml, IHC (Paraffin): 0, Western blot: 0 |
| Notes: |
Optimal dilution of the HSP90 beta antibody should be determined by the researcher |
| Intented use: |
This HSP90 beta antibodyis to be used only for research purposes and not for diagnostics |
| Uniprot #: |
P08238 |
| Purity: |
Antigen affinity |
| Description: |
Alternative splicing results in multiple transcript variants, And this gene is thought to play a role in gastric apoptosis and inflammation, It is mapped to chromosome 6p21, Pseudogenes have been identified on multiple chromosomes, This gene encodes a member of the heat shock protein 90 family, also called HSP90beta, is a protein that in humans is encoded by the HSP90AB1 gene, protein folding and degradation and morphological evolution, these proteins are involved in signal transduction, 1, Heat shock protein HSP 90-beta |
| Immunogen: |
Amino acids RRLSELLRYHTSQSGDEMTSLSEYVSRMKETQK of human HSP90AB1 were used as the immunogen for the Hsp90 beta antibody |
| Storage: |
Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the HSP90 beta antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term |
| Localization: |
Cytoplasmic |
| Properties: |
C, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24° |
| Gene target: |
HSP90 beta / HSP90AB1 |
| Short name: |
HSP90 beta Antibody / HSP90AB1 |
| Technique: |
antibodies against human proteins, antibodies for, Antibody |
| Alternative name: |
class B member 1, HSP90 b (Antibody to) / heat shock protein 90kDa a (cytosolic) |
| Alternative technique: |
antibodies |
| Alternative to gene target: |
BT, Cell surfaces, D6S182 and HSP84 and HSP90B and HSPC2 and HSPCB, HSP90AB1 and IDBG-89293 and ENSG00000096384 and 3326, Hsp90ab1 and IDBG-185482 and ENSMUSG00000023944 and 15516, class B member 1, leucine rich repeat containing receptor signaling pathway and biological process this GO :0038096 and Fc-gamma receptor signaling pathway involved in pha this GO cytosis and biological process this GO :0042470 and melanosome and cellular component this GO :0043524 and negative regulation of neuron apoptotic process and biological process this GO :0044325 and ion channel binding and molecular function this GO :0044822 and poly(A) RNA binding and molecular function this GO :0045087 and innate immune response and biological process this GO :0045429 and positive regulation of nitric oxide biosynthetic process and biological process this GO :0045793 and positive regulation of cell size and biological process this GO :0051082 and unfolded protein binding and molecular function this GO :0060334 and regulation of interferon-gamma-mediated signaling pathway and biological process this GO :0060338 and regulation of type I interferon-mediated signaling pathway and biological process this GO :0070062 and extracellular vesicular exosome and cellular component this GO :0071353 and cellular response to interleukin-4 and biological process this GO :0071407 and cellular response to organic cyclic compound and biological process this GO :0071902 and positive regulation of protein serine/threonine kinase activity and biological process, this GO :0001890 and placenta development and biological process this GO :0002134 and UTP binding and molecular function this GO :0002135 and CTP binding and molecular function this GO :0003725 and double-stranded RNA binding and molecular function this GO :0005515 and protein binding and molecular function this GO :0005524 and ATP binding and molecular function this GO :0005525 and GTP binding and molecular function this GO :0005622 and intracellular and cellular component this GO :0005737 and cytoplasm and cellular component this GO :0005739 and mitochondrion and cellular component this GO :0005829 and cytosol and cellular component this GO :0006457 and protein folding and biological process this GO :0006950 and response to stress and biological process this GO :0006986 and response to unfolded protein and biological process this GO :0007411 and axon guidance and biological process this GO :0008180 and COP9 signalosome and cellular component this GO :0009651 and response to salt stress and biological process this GO :0009986 and cell surface and cellular component this GO :0016020 and membrane and cellular component this GO :0016234 and inclusion body and cellular component this GO :0016323 and basolateral plasma membrane and cellular component this GO :0016324 and apical plasma membrane and cellular component this GO :0017098 and sulfonylurea receptor binding and molecular function this GO :0019901 and protein kinase binding and molecular function this GO :0023026 and MHC class II protein complex binding and molecular function this GO :0030235 and nitric-oxide synthase regulator activity and molecular function this GO :0030911 and TPR domain binding and molecular function this GO :0031526 and brush border membrane and cellular component this GO :0032092 and positive regulation of protein binding and biological process this GO :0032435 and negative regulation of proteasomal ubiquitin-dependent protein catabolic process and biological process this GO :0032564 and dATP binding and molecular function this GO :0033160 and positive regulation of protein import into nucleus, this GO :0002134 : UTP binding, this GO :0002134 : UTP binding and also this GO :0002135 : CTP binding and also this GO :0003725 : double-stranded RNA binding and also this GO :0005515 : protein binding and also this GO :0005524 : ATP binding and also this GO :0005525 : GTP binding and also this GO :0017098 : sulfonylurea receptor binding and also this GO :0019901 : protein kinase binding and also this GO :0023026 : MHC class II protein complex binding and also this GO :0030235 : nitric-oxide synthase regulator activity and also this GO :0030911 : TPR domain binding and also this GO :0032564 : dATP binding and also this GO :0044325 : ion channel binding and also this GO :0044822 : poly(A) RNA binding and also this GO :0051082 : unfolded protein binding, this GO :0002135 : CTP binding, this GO :0003725 : double-stranded RNA binding, this GO :0005515 : protein binding, this GO :0005524 : ATP binding, this GO :0005525 : GTP binding, this GO :0017098 : sulfonylurea receptor binding, this GO :0019901 : protein kinase binding, this GO :0023026 : MHC class II protein complex binding, this GO :0030235 : nitric-oxide synthase regulator activity, this GO :0030911 : TPR domain binding, this GO :0032564 : dATP binding, this GO :0044325 : ion channel binding, this GO :0044822 : poly(A) RNA binding, this GO :0051082 : unfolded protein binding, translocation and biological process this GO :0035872 and nucleotide-binding domain, unfolded protein binding, 64721 and IDBG-638535 and ENSBTAG00000047699 and 767874, heat shock protein 90kDa alpha (cytosolic) |
| Identity: |
5258 |
| Gene: |
HSP90AB1 |
More about : HSP90AB1 |
| Long gene name: |
heat shock protein 90 alpha family class B member 1 |
| Synonyms gene: |
HSPC2 HSPCB |
| Synonyms gene name: |
beta heat shock 90kDa protein 1, beta heat shock protein 90kDa alpha (cytosolic), class B member 1 , heat shock 90kD protein 1 |
| Locus: |
6p21, 1 |
| Discovery year: |
1990-06-27 |
| GenBank acession: |
AF275719 |
| Entrez gene record: |
3326 |
| Pubmed identfication: |
2768249 16269234 |
| RefSeq identity: |
NM_007355 |
| Classification: |
Heat shock 90kDa proteins |
| Havana BLAST/BLAT: |
OTTHUMG00000014761 |