HSP90 beta Antibody / HSP90AB1

Contact us
Catalog number: R31913
Price: 597 €
Supplier: MBS mono
Product name: HSP90 beta Antibody / HSP90AB1
Quantity: 0.05 ml
Related search:

More details :

Category: Antibody
Concentration: 2ml sterile DI water, 5mg/ml if reconstituted with 0
Form: Antigen affinity purified
Conjugation: Unconjugated
Clone: Polyclonal antibody
Recognised antigen: HSP90 beta / HSP90AB1
Host animal: Rabbit (Oryctolagus cuniculus)
Clonality: Polyclonal (rabbit origin)
Species reactivity: Due to limited knowledge and inability to test the antibody against all known species, Mouse (Mus musculus), Rat , we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens)
Tested applications: IHC-P, WB
Recommended dilutions: 1-0, 5-1ug/ml, 5ug/ml, IHC (Paraffin): 0, Western blot: 0
Notes: Optimal dilution of the HSP90 beta antibody should be determined by the researcher
Intented use: This HSP90 beta antibodyis to be used only for research purposes and not for diagnostics
Uniprot #: P08238
Purity: Antigen affinity
Description: Alternative splicing results in multiple transcript variants, And this gene is thought to play a role in gastric apoptosis and inflammation, It is mapped to chromosome 6p21, Pseudogenes have been identified on multiple chromosomes, This gene encodes a member of the heat shock protein 90 family, also called HSP90beta, is a protein that in humans is encoded by the HSP90AB1 gene, protein folding and degradation and morphological evolution, these proteins are involved in signal transduction, 1, Heat shock protein HSP 90-beta
Immunogen: Amino acids RRLSELLRYHTSQSGDEMTSLSEYVSRMKETQK of human HSP90AB1 were used as the immunogen for the Hsp90 beta antibody
Storage: Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the HSP90 beta antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term
Localization: Cytoplasmic
Properties: C, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24°
Gene target: HSP90 beta / HSP90AB1
Short name: HSP90 beta Antibody / HSP90AB1
Technique: antibodies against human proteins, antibodies for, Antibody
Alternative name: class B member 1, HSP90 b (Antibody to) / heat shock protein 90kDa a (cytosolic)
Alternative technique: antibodies
Alternative to gene target: BT, Cell surfaces, D6S182 and HSP84 and HSP90B and HSPC2 and HSPCB, HSP90AB1 and IDBG-89293 and ENSG00000096384 and 3326, Hsp90ab1 and IDBG-185482 and ENSMUSG00000023944 and 15516, class B member 1, leucine rich repeat containing receptor signaling pathway and biological process this GO :0038096 and Fc-gamma receptor signaling pathway involved in pha this GO cytosis and biological process this GO :0042470 and melanosome and cellular component this GO :0043524 and negative regulation of neuron apoptotic process and biological process this GO :0044325 and ion channel binding and molecular function this GO :0044822 and poly(A) RNA binding and molecular function this GO :0045087 and innate immune response and biological process this GO :0045429 and positive regulation of nitric oxide biosynthetic process and biological process this GO :0045793 and positive regulation of cell size and biological process this GO :0051082 and unfolded protein binding and molecular function this GO :0060334 and regulation of interferon-gamma-mediated signaling pathway and biological process this GO :0060338 and regulation of type I interferon-mediated signaling pathway and biological process this GO :0070062 and extracellular vesicular exosome and cellular component this GO :0071353 and cellular response to interleukin-4 and biological process this GO :0071407 and cellular response to organic cyclic compound and biological process this GO :0071902 and positive regulation of protein serine/threonine kinase activity and biological process, this GO :0001890 and placenta development and biological process this GO :0002134 and UTP binding and molecular function this GO :0002135 and CTP binding and molecular function this GO :0003725 and double-stranded RNA binding and molecular function this GO :0005515 and protein binding and molecular function this GO :0005524 and ATP binding and molecular function this GO :0005525 and GTP binding and molecular function this GO :0005622 and intracellular and cellular component this GO :0005737 and cytoplasm and cellular component this GO :0005739 and mitochondrion and cellular component this GO :0005829 and cytosol and cellular component this GO :0006457 and protein folding and biological process this GO :0006950 and response to stress and biological process this GO :0006986 and response to unfolded protein and biological process this GO :0007411 and axon guidance and biological process this GO :0008180 and COP9 signalosome and cellular component this GO :0009651 and response to salt stress and biological process this GO :0009986 and cell surface and cellular component this GO :0016020 and membrane and cellular component this GO :0016234 and inclusion body and cellular component this GO :0016323 and basolateral plasma membrane and cellular component this GO :0016324 and apical plasma membrane and cellular component this GO :0017098 and sulfonylurea receptor binding and molecular function this GO :0019901 and protein kinase binding and molecular function this GO :0023026 and MHC class II protein complex binding and molecular function this GO :0030235 and nitric-oxide synthase regulator activity and molecular function this GO :0030911 and TPR domain binding and molecular function this GO :0031526 and brush border membrane and cellular component this GO :0032092 and positive regulation of protein binding and biological process this GO :0032435 and negative regulation of proteasomal ubiquitin-dependent protein catabolic process and biological process this GO :0032564 and dATP binding and molecular function this GO :0033160 and positive regulation of protein import into nucleus, this GO :0002134 : UTP binding, this GO :0002134 : UTP binding and also this GO :0002135 : CTP binding and also this GO :0003725 : double-stranded RNA binding and also this GO :0005515 : protein binding and also this GO :0005524 : ATP binding and also this GO :0005525 : GTP binding and also this GO :0017098 : sulfonylurea receptor binding and also this GO :0019901 : protein kinase binding and also this GO :0023026 : MHC class II protein complex binding and also this GO :0030235 : nitric-oxide synthase regulator activity and also this GO :0030911 : TPR domain binding and also this GO :0032564 : dATP binding and also this GO :0044325 : ion channel binding and also this GO :0044822 : poly(A) RNA binding and also this GO :0051082 : unfolded protein binding, this GO :0002135 : CTP binding, this GO :0003725 : double-stranded RNA binding, this GO :0005515 : protein binding, this GO :0005524 : ATP binding, this GO :0005525 : GTP binding, this GO :0017098 : sulfonylurea receptor binding, this GO :0019901 : protein kinase binding, this GO :0023026 : MHC class II protein complex binding, this GO :0030235 : nitric-oxide synthase regulator activity, this GO :0030911 : TPR domain binding, this GO :0032564 : dATP binding, this GO :0044325 : ion channel binding, this GO :0044822 : poly(A) RNA binding, this GO :0051082 : unfolded protein binding, translocation and biological process this GO :0035872 and nucleotide-binding domain, unfolded protein binding, 64721 and IDBG-638535 and ENSBTAG00000047699 and 767874, heat shock protein 90kDa alpha (cytosolic)
Identity: 5258
Gene: HSP90AB1 | More about : HSP90AB1
Long gene name: heat shock protein 90 alpha family class B member 1
Synonyms gene: HSPC2 HSPCB
Synonyms gene name: beta heat shock 90kDa protein 1, beta heat shock protein 90kDa alpha (cytosolic), class B member 1 , heat shock 90kD protein 1
Locus: 6p21, 1
Discovery year: 1990-06-27
GenBank acession: AF275719
Entrez gene record: 3326
Pubmed identfication: 2768249 16269234
RefSeq identity: NM_007355
Classification: Heat shock 90kDa proteins
Havana BLAST/BLAT: OTTHUMG00000014761

Related Products :

AM03142PU-L anti-HSP90AB1 / HSP90 beta Antibody 0,2 mg 616 € acr human
AM03151PU-S anti-HSP90AB1 / HSP90 beta Antibody 25 Вµg 384 € acr human
AM06639SU-N anti-HSP90AB1 / HSP90 beta Antibody 0,1 ml 674 € acr human
AM06640SU-N anti-HSP90AB1 / HSP90 beta Antibody 0,1 ml 674 € acr human
AM26035PU-N anti-HSP90AB1 / HSP90 beta Antibody 0,1 mg 471 € acr human
AP02783PU-N anti-HSP90AB1 / HSP90 beta Antibody 0,1 ml 442 € acr human
AP02783PU-S anti-HSP90AB1 / HSP90 beta Antibody 50 Вµl 384 € acr human
AP06176PU-N anti-HSP90AB1 / HSP90 beta Antibody 0,1 mg 558 € acr human
B0013-1 anti-HSP90AB1 / HSP90 beta Antibody 50 Вµg 347 € acr human
B0013-2 anti-HSP90AB1 / HSP90 beta Antibody 0,1 mg 500 € acr human
B1210-1 anti-HSP90AB1 / HSP90 beta Antibody 50 Вµg 347 € acr human
B1210-2 anti-HSP90AB1 / HSP90 beta Antibody 0,1 mg 500 € acr human
CPA4432-100ul anti-HSP90AB1 / HSP90 beta Antibody 0,1 ml 442 € acr human
CPA4432-200ul anti-HSP90AB1 / HSP90 beta Antibody 0,2 ml 688 € acr human
CPA4432-30ul anti-HSP90AB1 / HSP90 beta Antibody 30 Вµl 326 € acr human
CPA9194-100ul anti-HSP90AB1 / HSP90 beta Antibody 0,1 ml 442 € acr human
CPA9194-200ul anti-HSP90AB1 / HSP90 beta Antibody 0,2 ml 688 € acr human
CPA9194-30ul anti-HSP90AB1 / HSP90 beta Antibody 30 Вµl 326 € acr human
CPA4678-100ul anti-HSP90AB1 / HSP90 beta pSer226 Antibody 0,1 ml 529 € acr human
CPA4678-200ul anti-HSP90AB1 / HSP90 beta pSer226 Antibody 0,2 ml 819 € acr human
CPA4678-30ul anti-HSP90AB1 / HSP90 beta pSer226 Antibody 30 Вµl 355 € acr human
AP02466PU-N anti-HSP90AB1 / HSP90 beta pSer254 Antibody 0,1 ml 514 € acr human
AP02466PU-S anti-HSP90AB1 / HSP90 beta pSer254 Antibody 50 Вµl 398 € acr human
AP07423PU-N anti-HSP90AB1 / HSP90 beta pSer254 Antibody 50 Вµg 732 € acr human
CPA3244-100ul anti-HSP90AB1 / HSP90 beta pSer254 Antibody 0,1 ml 529 € acr human
CPA3244-200ul anti-HSP90AB1 / HSP90 beta pSer254 Antibody 0,2 ml 819 € acr human
CPA3244-30ul anti-HSP90AB1 / HSP90 beta pSer254 Antibody 30 Вµl 355 € acr human
AP54991SU-N anti-HSP90AB1 / HSP90 beta pTyr484 Antibody 0,2 ml 630 € acr human
R31913 HSP90 beta Antibody / HSP90AB1 0.1mg 406 € NJS poly human
GENTAUR-58bde82f585d9 Mouse Monoclonal [clone 5G4] (IgG1) to Human HSP90AB1 / HSP90 Antibody 0.05 ml 597 € MBS mono human