HSP90 alpha Antibody / HSP90AA1

Contact us
Catalog number: R31907
Price: 406 €
Supplier: NJS poly
Product name: HSP90 alpha Antibody / HSP90AA1
Quantity: 0.1mg
Other quantities: 0.1mg 389€
Related search:

More details :

Category: Antibody
Concentration: 2ml sterile DI water, 5mg/ml if reconstituted with 0
Form: Antigen affinity purified
Conjugation: Unconjugated
Clone: Polyclonal antibody
Recognised antigen: HSP90 alpha / HSP90AA1
Host animal: Rabbit (Oryctolagus cuniculus)
Clonality: Polyclonal (rabbit origin)
Species reactivity: Due to limited knowledge and inability to test the antibody against all known species, Mouse (Mus musculus), Rat , we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens)
Tested applications: IHC-P, WB
Recommended dilutions: 1-0, 5-1ug/ml, 5ug/ml, IHC (Paraffin): 0, Western blot: 0
Notes: Optimal dilution of the HSP90 alpha antibody should be determined by the researcher
Intented use: This HSP90 alpha antibodyis to be used only for research purposes and not for diagnostics
Uniprot #: P07900
Purity: Antigen affinity
Description: Complemented by the constitutively expressed paralog Hsp90B which shares over 85% amino acid sequence identity, Current research on Hsp90A focuses in its role as a drug target due to its interaction with a large number of tumor promoting proteins and its role in cellular stress adaptation, HSP90AA1, Hsp90A expression is initiated when a cell experiences proteotoxic stress, Once expressed Hsp90A dimers operate as molecular chaperones that bind and fold other proteins into their functional 3-dimensional structures, The gene, This molecular chaperoning ability of Hsp90A is driven by a cycle of structural rearrangements fueled by ATP hydrolysis, encodes the human stress-inducible 90-kDa heat shock protein alpha (Hsp90A), Heat shock protein HSP 90-alpha is a protein that in humans is encoded by the HSP90AA1 gene
Immunogen: Amino acids QNRKKLSELLRYYTSASGDEMVSLKDYCTRMKENQ of human HSP90AA1 were used as the immunogen for the HSP90 alpha antibody
Storage: Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the HSP90 alpha antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term
Localization: Cytoplasmic
Properties: C, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24°
Gene target: HSP90 alpha / HSP90AA1
Short name: HSP90 alpha Antibody / HSP90AA1
Technique: antibodies against human proteins, antibodies for, Antibody
Alternative name: HSP90 a (Antibody to) / HSP90AA1
Alternative technique: antibodies
Identity: 5253
Gene: HSP90AA1 | More about : HSP90AA1
Long gene name: heat shock protein 90 alpha family class A member 1
Synonyms gene: HSPC1 HSPCA
Synonyms gene name: alpha heat shock 90kDa protein 1, alpha heat shock protein 90kDa alpha (cytosolic), class A member 1 , heat shock 90kD protein 1
Synonyms: Hsp89 Hsp90 FLJ31884 HSP90N
Locus: 14q32, 31
Discovery year: 1990-06-27
GenBank acession: M27024
Entrez gene record: 3320
Pubmed identfication: 2527334 16269234
RefSeq identity: NM_005348
Classification: Heat shock 90kDa proteins
Havana BLAST/BLAT: OTTHUMG00000171752

Related Products :