| Category: |
Antibody |
| Concentration: |
2ml sterile DI water, 5mg/ml if reconstituted with 0 |
| Form: |
Antigen affinity purified |
| Conjugation: |
Unconjugated |
| Clone: |
Polyclonal antibody |
| Recognised antigen: |
HSP90 alpha / HSP90AA1 |
| Host animal: |
Rabbit (Oryctolagus cuniculus) |
| Clonality: |
Polyclonal (rabbit origin) |
| Species reactivity: |
Due to limited knowledge and inability to test the antibody against all known species, Mouse (Mus musculus), Rat , we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens) |
| Tested applications: |
IHC-P, WB |
| Recommended dilutions: |
1-0, 5-1ug/ml, 5ug/ml, IHC (Paraffin): 0, Western blot: 0 |
| Notes: |
Optimal dilution of the HSP90 alpha antibody should be determined by the researcher |
| Intented use: |
This HSP90 alpha antibodyis to be used only for research purposes and not for diagnostics |
| Uniprot #: |
P07900 |
| Purity: |
Antigen affinity |
| Description: |
Complemented by the constitutively expressed paralog Hsp90B which shares over 85% amino acid sequence identity, Current research on Hsp90A focuses in its role as a drug target due to its interaction with a large number of tumor promoting proteins and its role in cellular stress adaptation, HSP90AA1, Hsp90A expression is initiated when a cell experiences proteotoxic stress, Once expressed Hsp90A dimers operate as molecular chaperones that bind and fold other proteins into their functional 3-dimensional structures, The gene, This molecular chaperoning ability of Hsp90A is driven by a cycle of structural rearrangements fueled by ATP hydrolysis, encodes the human stress-inducible 90-kDa heat shock protein alpha (Hsp90A), Heat shock protein HSP 90-alpha is a protein that in humans is encoded by the HSP90AA1 gene |
| Immunogen: |
Amino acids QNRKKLSELLRYYTSASGDEMVSLKDYCTRMKENQ of human HSP90AA1 were used as the immunogen for the HSP90 alpha antibody |
| Storage: |
Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the HSP90 alpha antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term |
| Localization: |
Cytoplasmic |
| Properties: |
C, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24° |
| Gene target: |
HSP90 alpha / HSP90AA1 |
| Short name: |
HSP90 alpha Antibody / HSP90AA1 |
| Technique: |
antibodies against human proteins, antibodies for, Antibody |
| Alternative name: |
HSP90 a (Antibody to) / HSP90AA1 |
| Alternative technique: |
antibodies |
| Identity: |
5253 |
| Gene: |
HSP90AA1 |
More about : HSP90AA1 |
| Long gene name: |
heat shock protein 90 alpha family class A member 1 |
| Synonyms gene: |
HSPC1 HSPCA |
| Synonyms gene name: |
alpha heat shock 90kDa protein 1, alpha heat shock protein 90kDa alpha (cytosolic), class A member 1 , heat shock 90kD protein 1 |
| Synonyms: |
Hsp89 Hsp90 FLJ31884 HSP90N |
| Locus: |
14q32, 31 |
| Discovery year: |
1990-06-27 |
| GenBank acession: |
M27024 |
| Entrez gene record: |
3320 |
| Pubmed identfication: |
2527334 16269234 |
| RefSeq identity: |
NM_005348 |
| Classification: |
Heat shock 90kDa proteins |
| Havana BLAST/BLAT: |
OTTHUMG00000171752 |