FABP1 Antibody (liver)

Contact us
Catalog number: R31902
Price: 1934 €
Supplier: MBS Recombinant Proteins
Product name: FABP1 Antibody (liver)
Quantity: 1000ug
Other quantities: 0.1mg 389€
Related search:

More details :

Category: Antibody
Concentration: 2ml sterile DI water, 5mg/ml if reconstituted with 0
Form: Antigen affinity purified
Conjugation: Unconjugated
Clone: Polyclonal antibody
Recognised antigen: FABP1 (liver)
Host animal: Rabbit (Oryctolagus cuniculus)
Clonality: Polyclonal (rabbit origin)
Species reactivity: Due to limited knowledge and inability to test the antibody against all known species, Mouse (Mus musculus), Rat , we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens)
Tested applications: IHC-P, WB
Recommended dilutions: 1-0, 5-1ug/ml, 5ug/ml, IHC (Paraffin): 0, Western blot: 0
Notes: Optimal dilution of the FABP antibody should be determined by the researcher
Intented use: This FABP antibodyis to be used only for research purposes and not for diagnostics
Uniprot #: P07148
Purity: Antigen affinity
Description: FABP1 and FABP6 (the ileal fatty acid binding protein) are also able to bind bile acids, FABP1 encodes the fatty acid binding protein found in liver, Fatty acid binding proteins are a family of small, It is thought that FABPs roles include fatty acid uptake, The liver form of FABP may be identical to the major liver protein-1 (Lvp-1), also known as FABP1 or FABPL, and metaboism, and other small molecules, bilirubin, cytoplasmic proteins that bind free fatty acids, highly conserved, is a human gene locating at 2p11, liver, organic anions, their CoA derivatives, transport, which is encoded by a gene situated within 1 cM of Ly-2, Fatty acid binding protein 1
Immunogen: Amino acids KYQLQSQENFEAFMKAIGLPEELIQKGKDIK of human FABP were used as the immunogen for the FABP antibody
Storage: Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the FABP antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term
Localization: cytoplasmic, Nuclear
Properties: C, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24°
Gene target: FABP1 (liver)
Short name: FABP1 Antibody (liver)
Technique: antibodies against human proteins, antibodies for, Antibody
Alternative name: FABP1 (Antibody to) (liver)
Alternative technique: antibodies
Identity: 3555
Gene: FABP1 | More about : FABP1
Long gene name: fatty acid binding protein 1
Synonyms gene name: fatty acid binding protein 1, liver
Synonyms: L-FABP
Locus: 2p11, 2
Discovery year: 2001-06-22
GenBank acession: M10617
Entrez gene record: 2168
Pubmed identfication: 3012800 17698986
RefSeq identity: NM_001443
Classification: Fatty acid binding protein family
Havana BLAST/BLAT: OTTHUMG00000130312

Related Products :

MBS623619 Fatty Acid Binding Protein, Liver (Liver-type Fatty Acid-binding Protein, L-FABP, Fatty Acid-binding Protein 1, FABP1, Fabplg, MGC108756, p14, RATFABPLG, Squalene- and Sterol-carrier Protein, SCP, Z-protein) Antibody 100ug 1078 € MBS Polyclonals_1 human
P721-1 anti-FABP1 (Liver) Antibody 0,1 mg 282 € acr human
GENTAUR-58bdc357e95b4 Anti- Fatty Acid Binding Protein 1, Liver (FABP1) Antibody 100ug 564 € MBS Polyclonals human
GENTAUR-58bdc760b9171 Anti- Fatty Acid Binding Protein 1, Liver (FABP1) Antibody 100ug 608 € MBS Polyclonals human
GENTAUR-58bdc8ddac326 Anti- Fatty Acid Binding Protein 1, Liver (FABP1) Antibody 100ug 509 € MBS Polyclonals human
GENTAUR-58bdcc094829a Anti- Fatty Acid Binding Protein 1, Liver (FABP1) Antibody 100ug 542 € MBS Polyclonals human
GENTAUR-58bdcc0a2d00b Anti- Fatty Acid Binding Protein 1, Liver (FABP1) Antibody 50ug 409 € MBS Polyclonals human
GENTAUR-58bdcd9609923 Anti- Fatty Acid Binding Protein 1, Liver (FABP1) Antibody 50ug 365 € MBS Polyclonals human
GENTAUR-58bdcd9671138 Anti- Fatty Acid Binding Protein 1, Liver (FABP1) Antibody 100ug 470 € MBS Polyclonals human
GENTAUR-58bdcfd80948c Anti- Fatty Acid Binding Protein 1, Liver (FABP1) Antibody 50ug 382 € MBS Polyclonals human
GENTAUR-58bdcfd890ce1 Anti- Fatty Acid Binding Protein 1, Liver (FABP1) Antibody 100ug 503 € MBS Polyclonals human
GENTAUR-58bddacab83c7 Anti- Fatty Acid Binding Protein 1, Liver (FABP1) Antibody 100ug 603 € MBS Polyclonals human
GENTAUR-58bddb875ba15 Anti- Fatty Acid Binding Protein 1, Liver (FABP1) Antibody 100ug 542 € MBS Polyclonals human
GENTAUR-58bddb9b8ab57 Anti- Fatty Acid Binding Protein 1, Liver (FABP1) Antibody 100ug 625 € MBS Polyclonals human
R30331 FABP1 Antibody (Liver) 0.1mg 389 € NJS poly human
R31902 FABP1 Antibody (liver) 0.1mg 406 € NJS poly human
R36476-100UG FABP1 Antibody (liver) 0.1mg 406 € NJS poly human
E-EL-Ch0269 Chicken FABP1 (Fatty Acid Binding Protein 1, Liver) ELISA Kit 96T 568 € elabsciences chicken
AE44884PI-48 ELISA test for Pig Fatty acid-binding protein, liver (FABP1) 1x plate of 48 wells 402 € abebio pig
EKU04028 Fatty Acid Binding Protein 1, Liver (FABP1) ELISA kit 1 plate of 96 wells 783 € Biomatik ELISA kits human
EKU04029 Fatty Acid Binding Protein 1, Liver (FABP1) ELISA kit 1 plate of 96 wells 930 € Biomatik ELISA kits human
EKU04030 Fatty Acid Binding Protein 1, Liver (FABP1) ELISA kit 1 plate of 96 wells 846 € Biomatik ELISA kits human
DL-FABP1-Hu Human Fatty Acid Binding Protein 1, Liver FABP1 ELISA Kit 96T 869 € DL elisas human
AE44884PI-96 Pig Fatty acid-binding protein, liver (FABP1) ELISA Kit 1x plate of 96 wells 671 € abebio pig
DL-FABP1-p Porcine Fatty Acid Binding Protein 1, Liver FABP1 ELISA Kit 96T 1020 € DL elisas porcine
DL-FABP1-Ra Rat Fatty Acid Binding Protein 1, Liver FABP1 ELISA Kit 96T 962 € DL elisas rat
GENTAUR-58bb6045a65f2 Takifugu rubripes Fatty acid-binding protein, liver-type (fabp1) 100ug 1431 € MBS Recombinant Proteins human
GENTAUR-58bb6046008fc Takifugu rubripes Fatty acid-binding protein, liver-type (fabp1) 1000ug 1431 € MBS Recombinant Proteins human
GENTAUR-58bb604a1deaf Takifugu rubripes Fatty acid-binding protein, liver-type (fabp1) 100ug 1934 € MBS Recombinant Proteins human
GENTAUR-58bb604a6227f Takifugu rubripes Fatty acid-binding protein, liver-type (fabp1) 1000ug 1934 € MBS Recombinant Proteins human