| Category: |
Antibody |
| Concentration: |
2ml sterile DI water, 5mg/ml if reconstituted with 0 |
| Form: |
Antigen affinity purified |
| Conjugation: |
Unconjugated |
| Clone: |
Polyclonal antibody |
| Recognised antigen: |
FABP1 (liver) |
| Host animal: |
Rabbit (Oryctolagus cuniculus) |
| Clonality: |
Polyclonal (rabbit origin) |
| Species reactivity: |
Due to limited knowledge and inability to test the antibody against all known species, Mouse (Mus musculus), Rat , we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens) |
| Tested applications: |
IHC-P, WB |
| Recommended dilutions: |
1-0, 5-1ug/ml, 5ug/ml, IHC (Paraffin): 0, Western blot: 0 |
| Notes: |
Optimal dilution of the FABP antibody should be determined by the researcher |
| Intented use: |
This FABP antibodyis to be used only for research purposes and not for diagnostics |
| Uniprot #: |
P07148 |
| Purity: |
Antigen affinity |
| Description: |
FABP1 and FABP6 (the ileal fatty acid binding protein) are also able to bind bile acids, FABP1 encodes the fatty acid binding protein found in liver, Fatty acid binding proteins are a family of small, It is thought that FABPs roles include fatty acid uptake, The liver form of FABP may be identical to the major liver protein-1 (Lvp-1), also known as FABP1 or FABPL, and metaboism, and other small molecules, bilirubin, cytoplasmic proteins that bind free fatty acids, highly conserved, is a human gene locating at 2p11, liver, organic anions, their CoA derivatives, transport, which is encoded by a gene situated within 1 cM of Ly-2, Fatty acid binding protein 1 |
| Immunogen: |
Amino acids KYQLQSQENFEAFMKAIGLPEELIQKGKDIK of human FABP were used as the immunogen for the FABP antibody |
| Storage: |
Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the FABP antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term |
| Localization: |
cytoplasmic, Nuclear |
| Properties: |
C, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24° |
| Gene target: |
FABP1 (liver) |
| Short name: |
FABP1 Antibody (liver) |
| Technique: |
antibodies against human proteins, antibodies for, Antibody |
| Alternative name: |
FABP1 (Antibody to) (liver) |
| Alternative technique: |
antibodies |
| Identity: |
3555 |
| Gene: |
FABP1 |
More about : FABP1 |
| Long gene name: |
fatty acid binding protein 1 |
| Synonyms gene name: |
fatty acid binding protein 1, liver |
| Synonyms: |
L-FABP |
| Locus: |
2p11, 2 |
| Discovery year: |
2001-06-22 |
| GenBank acession: |
M10617 |
| Entrez gene record: |
2168 |
| Pubmed identfication: |
3012800 17698986 |
| RefSeq identity: |
NM_001443 |
| Classification: |
Fatty acid binding protein family |
| Havana BLAST/BLAT: |
OTTHUMG00000130312 |