AIFM1 Antibody

Contact us
Catalog number: R31851
Price: 265 €
Supplier: MBS Polyclonals
Product name: AIFM1 Antibody
Quantity: 0.06 ml
Other quantities: 0.1mg 406€ 1 vial 521€
Related search:

More details :

Category: Antibody
Concentration: 2ml sterile DI water, 5mg/ml if reconstituted with 0
Form: Antigen affinity purified
Conjugation: Unconjugated
Clone: Polyclonal antibody
Recognised antigen: AIFM1
Host animal: Rabbit (Oryctolagus cuniculus)
Clonality: Polyclonal (rabbit origin)
Species reactivity: Due to limited knowledge and inability to test the antibody against all known species, Mouse (Mus musculus), Rat , we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens)
Tested applications: ICC, IHC-P, WB
Recommended dilutions: 1-0, 5-1ug/ml, 5-1ug/ml, 5ug/ml, ICC: 0, IHC (Paraffin): 0, Western blot: 0
Notes: Optimal dilution of the AIF antibody should be determined by the researcher
Intented use: This AIF antibodyis to be used only for research purposes and not for diagnostics
Uniprot #: O95831
Purity: Antigen affinity
Description: A related pseudogene has been identified on chromosome 10, AIFM1 gene is mapped to Xq26, In addition, Induction of apoptosis results in the translocation of this protein to the nucleus where it affects chromosome condensation and fragmentation, Mutations in this gene cause combined oxidative phosphorylation deficiency 6, This gene encodes a flavoprotein essential for nuclear disassembly in apoptotic cells, also known as AIF or PDCD8 is a protein that in humans is encoded by the AIFM1 gene, and it is found in the mitochondrial intermembrane space in healthy cells, mitochondrial, this gene product induces mitochondria to release the apoptogenic proteins cytochrome c and caspase-9, which results in a severe mitochondrial encephalomyopathy, 1 based on an alignment of the AIFM1 sequence with the genomic sequence, Apoptosis-inducing factor 1
Immunogen: Amino acids FNRMPIARKIIKDGEQHEDLNEVAKLFNIHED of human AIF were used as the immunogen for the AIF antibody
Storage: Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the AIF antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term
Localization: Cytoplasmic
Properties: C, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24°
Gene target: AIFM1
Short name: AIFM1 Antibody
Technique: antibodies against human proteins, antibodies for, Antibody
Alternative name: 1 (Antibody to), mitochondrion-associated, apoptosis-inducing factor
Alternative technique: antibodies
Alternative to gene target: 1, AIF and CMT2D and CMTX4 and COWCK and COXPD6 and NADMR and NAMSD and PDCD8, AIFM1 and IDBG-630636 and ENSBTAG00000006838 and 535714, AIFM1 and IDBG-85972 and ENSG00000156709 and 9131, Aifm1 and IDBG-143630 and ENSMUSG00000036932 and 26926, acting on NAD(P)H, acting on NAD(P)H and also this GO :0046983 : protein dimerization activity and also this GO :0050660 : flavin adenine dinucleotide binding and also this GO :0071949 : FAD binding, acting on NAD(P)H and molecular function this GO :0030182 and neuron differentiation and biological process this GO :0030261 and chromosome condensation and biological process this GO :0032981 and mitochondrial respiratory chain complex I assembly and biological process this GO :0043065 and positive regulation of apoptotic process and biological process this GO :0045454 and cell redox homeostasis and biological process this GO :0046983 and protein dimerization activity and molecular function this GO :0048471 and perinuclear region of cytoplasm and cellular component this GO :0050660 and flavin adenine dinucleotide binding and molecular function this GO :0051402 and neuron apoptotic process and biological process this GO :0055114 and oxidation-reduction process and biological process this GO :0070059 and intrinsic apoptotic signaling pathway in response to endoplasmic reticulum stress and biological process this GO :0071949 and FAD binding and molecular function this GO :1902510 and regulation of apoptotic DNA fragmentation and biological process, mitochondrion-associated, nuclei, oxidoreductase activity, this GO :0003677 and DNA binding and molecular function this GO :0005515 and protein binding and molecular function this GO :0005634 and nucleus and cellular component this GO :0005737 and cytoplasm and cellular component this GO :0005739 and mitochondrion and cellular component this GO :0005743 and mitochondrial inner membrane and cellular component this GO :0005758 and mitochondrial intermembrane space and cellular component this GO :0005829 and cytosol and cellular component this GO :0006308 and DNA catabolic process and biological process this GO :0006915 and apoptotic process and biological process this GO :0006919 and activation of cysteine-type endopeptidase activity involved in apoptotic process and biological process this GO :0009055 and electron carrier activity and molecular function this GO :0010942 and positive regulation of cell death and biological process this GO :0016174 and NAD(P)H oxidase activity and molecular function this GO :0016491 and oxidoreductase activity and molecular function this GO :0016651 and oxidoreductase activity, this GO :0003677 : DNA binding, this GO :0003677 : DNA binding and also this GO :0005515 : protein binding and also this GO :0009055 : electron carrier activity and also this GO :0016174 : NAD(P)H oxidase activity and also this GO :0016491 : oxidoreductase activity and also this GO :0016651 : oxidoreductase activity, this GO :0005515 : protein binding, this GO :0009055 : electron carrier activity, this GO :0016174 : NAD(P)H oxidase activity, this GO :0016491 : oxidoreductase activity, this GO :0016651 : oxidoreductase activity, this GO :0046983 : protein dimerization activity, this GO :0050660 : flavin adenine dinucleotide binding, this GO :0071949 : FAD binding, apoptosis-inducing factor
Identity: 8768
Gene: AIFM1 | More about : AIFM1
Long gene name: apoptosis inducing factor mitochondria associated 1
Synonyms gene: PDCD8 NAMSD
Synonyms gene name: 1 apoptosis inducing factor, axonal, mitochondria associated 1 , mitochondrion-associated, motor-sensory with deafness and mental retardation (Cowchock syndrome) apoptosis-inducing factor, programmed cell death 8 (apoptosis-inducing factor) neuropathy
Synonyms: AIF CMTX4
Locus: Xq26, 1
Discovery year: 1999-05-28
GenBank acession: AF100928
Entrez gene record: 9131
Pubmed identfication: 9989411 23217327
Havana BLAST/BLAT: OTTHUMG00000022392
Locus Specific Databases: Mental Retardation database

Related Products :

GWB-5FF138 Apoptosis-inducing Factor (AIFM1 PDCD8) Rabbit antibody to or anti-Human Polyclonal (aa517-531) antibody 1 tube 648 € genways human
GWB-A99E49 Apoptosis-inducing Factor (AIFM1 PDCD8) Rabbit antibody to or anti-Human Polyclonal (aa593-606) antibody 1 vial 602 € genways human
GWB-MX363C AIFM1 antibody 1 vial 521 € genways human
R31851 AIFM1 Antibody 0.1mg 406 € NJS poly human
R33400-100UG AIFM1 Antibody 0.1mg 406 € NJS poly human
R34791-100UG AIFM1 Antibody 0.1mg 406 € NJS poly human
AR50415PU-N anti-AIFM1 / AIF (27-172, His-tag) Antibody 0,1 mg 1109 € acr human
AR50415PU-S anti-AIFM1 / AIF (27-172, His-tag) Antibody 20 Вµg 485 € acr human
SP1293P anti-AIFM1 / AIF (517-531) Antibody 0,1 mg 529 € acr human
SP1293PS anti-AIFM1 / AIF (517-531) Antibody 50 Вµg 456 € acr human
AP07809PU-N anti-AIFM1 / AIF (593-606) Antibody 50 Вµg 732 € acr human
AP22931PU-N anti-AIFM1 / AIF (593-606) Antibody 50 Вµg 732 € acr human
SP1292P anti-AIFM1 / AIF (593-606) Antibody 0,1 mg 529 € acr human
AR51418PU-N anti-AIFM1 / AIF (98-609, His-tag) Antibody 0,5 mg 1109 € acr human
AR51418PU-S anti-AIFM1 / AIF (98-609, His-tag) Antibody 0,1 mg 485 € acr human
AM06656SU-N anti-AIFM1 / AIF Antibody 0,1 ml 674 € acr human
C13024-1 anti-AIFM1 / AIF Antibody 50 Вµg 347 € acr human
C13024-2 anti-AIFM1 / AIF Antibody 0,1 mg 500 € acr human
CPA2356-100ul anti-AIFM1 / AIF Antibody 0,1 ml 442 € acr human
CPA2356-200ul anti-AIFM1 / AIF Antibody 0,2 ml 688 € acr human
CPA2356-30ul anti-AIFM1 / AIF Antibody 30 Вµl 326 € acr human
AP30029CP-N anti-AIFM1 / AIF Control Peptide Antibody 50 Вµg 282 € acr human
AP30030CP-N anti-AIFM1 / AIF Control Peptide Antibody 50 Вµg 282 € acr human
AP30031CP-N anti-AIFM1 / AIF Control Peptide Antibody 50 Вµg 282 € acr human
AP22915PU-N anti-AIFM1 / AIF (N-term) Antibody 50 Вµg 732 € acr human
SP1294P anti-AIFM1 / AIF (N-term) Antibody 0,1 mg 529 € acr human
A03A0123 anti-AIFM1 Antibody 200ug (50ug, 100ug available) 465 € Bluegen antibodies human
GENTAUR-58bdee0911a9a Anti- AIFM1 Antibody 0.06 ml 265 € MBS Polyclonals human
GENTAUR-58bdee098251c Anti- AIFM1 Antibody 0.12 ml 348 € MBS Polyclonals human
GENTAUR-58bdfca6144d3 Anti- AIFM1 Antibody 0.06 ml 265 € MBS Polyclonals human