Pokemon Antibody / ZBTB7A

Contact us
Catalog number: R31842
Price: 406 €
Supplier: NJS poly
Product name: Pokemon Antibody / ZBTB7A
Quantity: 0.1mg
Other quantities: 0.1mg 406€
Related search:

More details :

Category: Antibody
Concentration: 2ml sterile DI water, 5mg/ml if reconstituted with 0
Form: Antigen affinity purified
Conjugation: Unconjugated
Clone: Polyclonal antibody
Recognised antigen: Pokemon / ZBTB7A
Host animal: Rabbit (Oryctolagus cuniculus)
Clonality: Polyclonal (rabbit origin)
Species reactivity: Due to limited knowledge and inability to test the antibody against all known species, Rat , we cannot guarantee that no other cross reactivity can occur, Mouse (Mus musculus)
Tested applications: IHC-P, WB
Recommended dilutions: 1-0, 5-1ug/ml, 5ug/ml, IHC (Paraffin): 0, Western blot: 0
Notes: Optimal dilution of the ZBTB7A antibody should be determined by the researcher
Intented use: This ZBTB7A antibodyis to be used only for research purposes and not for diagnostics
Uniprot #: O88939
Purity: Antigen affinity
Description: Inactivation of ZBTB7A in vivo leads to RB downregulation, It has a critical oncosuppressive role in the prostate, It has been showed that ZBTB7A physically interacts with SOX9 and functionally antagonizes its transcriptional activity on key target genes such as MIA, Notably, Prostate-specific inactivation of ZBTB7A leads to a marked acceleration of PTEN loss-driven prostate tumorigenesis through bypass of PTEN loss-induced cellular senescence, Therefore, ZBTB7A is identified as a context-dependent cancer gene that can act as an oncogene in some contexts but that also has oncosuppressive-like activity in PTEN-null tumors, a long noncoding RNA precursor for an RB-targeting microRNA, also called Pokemon and FBI-1, and H19, and invasive prostate cancer, as well as downregulated at both the mRNA and protein levels, bypass of PTEN loss-induced cellular senescence, in a subset of human advanced prostate cancers, is a protein that in humans is encoded by the ZBTB7A gene, it has been also found that ZBTB7A is genetically lost, which is involved in tumor cell invasion, Zinc finger and BTB domain-containing protein 7A
Immunogen: Amino acids DLLERQILAADDVGDASQPDGAGPTDQRNLLRAKEYLEF of mouse ZBTB7A were used as the immunogen for the ZBTB7A antibody
Storage: Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the ZBTB7A antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term
Localization: Nuclear
Properties: C, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24°
Gene target: Pokemon / ZBTB7A
Short name: Pokemon Antibody / ZBTB7A
Technique: antibodies against human proteins, antibodies for, Antibody
Alternative name: Pokemon (Antibody to) / ZBTB7A
Alternative technique: antibodies
Identity: 18078
Gene: ZBTB7A | More about : ZBTB7A
Long gene name: zinc finger and BTB domain containing 7A
Synonyms gene: ZBTB7
Synonyms gene name: zinc finger and BTB domain containing 7
Synonyms: FBI-1 LRF DKFZp547O146 pokemon ZNF857A
Synonyms name: HIV-1 inducer of short transcripts binding protein lymphoma related factor , zinc finger and BTB domain containing 7A
Locus: 19p13, 3
Discovery year: 2004-01-16
GenBank acession: AF000561
Entrez gene record: 51341
Pubmed identfication: 9973611 9927193
RefSeq identity: NM_015898
Classification: BTB domain containing Zinc fingers C2H2-type
Havana BLAST/BLAT: OTTHUMG00000181792

Related Products :