APRIL Antibody

Contact us
Catalog number: R31837
Price: 282 €
Supplier: acr
Product name: APRIL Antibody
Quantity: 50 Вµg
Other quantities: 0.1mg 406€ 1 tube 648€ 1 volume 648€ 1 x 1 vial 648€
Related search:

More details :

Category: Antibody
Concentration: 2ml sterile DI water, 5mg/ml if reconstituted with 0
Form: Antigen affinity purified
Conjugation: Unconjugated
Clone: Polyclonal antibody
Recognised antigen: APRIL
Host animal: Rabbit (Oryctolagus cuniculus)
Clonality: Polyclonal (rabbit origin)
Species reactivity: Due to limited knowledge and inability to test the antibody against all known species, we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens)
Tested applications: ELISA, WB
Recommended dilutions: 1-0, 1-0, 5ug/ml, 5ug/ml, ELISA : 0, Western blot: 0
Notes: Optimal dilution of the APRIL antibody should be determined by the researcher
Intented use: This APRIL antibodyis to be used only for research purposes and not for diagnostics
Uniprot #: O75888
Purity: Antigen affinity
Description: Alternative splicing results in multiple transcript variants, And this protein is a ligand for TNFRSF17/BCMA, In vitro experiments suggested that this protein may be able to induce apoptosis through its interaction with other TNF receptor family proteins such as TNFRSF6/FAS and TNFRSF14/HVEM, Some transcripts that skip the last exon of the upstream gene (TNFSF12) and continue into the second exon of this gene have been identified, TNFSF12-TNFSF13, The protein encoded by this gene is a member of the tumor necrosis factor (TNF) ligand family, This protein and its receptor are both found to be important for B cell development, a member of the TNF receptor family, also known as tumor necrosis factor ligand superfamily member 13 (TNFSF13), is a protein of the TNF superfamily recognized by the cell surface receptor TACI, such read-through transcripts are contained in GeneID 407977, A proliferation-inducing ligand (APRIL)
Immunogen: Amino acids PINATSKDDSDVTEVMWQPALRRGRGLQAQ of human APRIL were used as the immunogen for the APRIL antibody
Storage: Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the APRIL antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term
Properties: C, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24°
Gene target: APRIL
Short name: APRIL Antibody
Technique: antibodies against human proteins, antibodies for, Antibody
Alternative name: APRIL (Antibody to)
Alternative technique: antibodies
Identity: 11928
Gene: TNFSF13 | More about : TNFSF13
Long gene name: tumor necrosis factor superfamily member 13
Synonyms gene name: member 13 , tumor necrosis factor (ligand) superfamily
Synonyms: APRIL CD256
Locus: 17p13, 1
Discovery year: 1998-12-04
GenBank acession: AF046888
Entrez gene record: 8741
Pubmed identfication: 9743536
RefSeq identity: NM_003808
Classification: Tumor necrosis factor superfamily CD molecules
Havana BLAST/BLAT: OTTHUMG00000108145

Related Products :

GWB-4DD9B5 TNF Ligand Superfamily, Member 13 (TNFSF13/APRIL) Rabbit antibody to or anti-Human Polyclonal (aa1-17) antibody 1 x 1 vial 602 € genways human
XP-5103 anti-APRIL Antibody 0.1 mg 180 € proscience human
XP-5103Bt anti-APRIL Antibody 0.05 mg 180 € proscience human
XA-1019 anti-APRIL Antibody [Aprily-1] 0.1 mg 180 € proscience human
XA-1020 anti-APRIL Antibody [Aprily-8] 0.1 mg 180 € proscience human
XA-1014 anti-APRIL Antibody [Sacha-1] 0.1 mg 180 € proscience human
XA-1025 anti-APRIL Antibody [Sacha-2] 0.1 mg 180 € proscience human
AP08476PU-N anti-CD256 / APRIL (1-17) Antibody 50 Вµg 732 € acr human
AR51422PU-N anti-CD256 / APRIL (105-247, T7 tag) Antibody 0,5 mg 1109 € acr human
AR51422PU-S anti-CD256 / APRIL (105-247, T7 tag) Antibody 0,1 mg 485 € acr human
AP23133PU-N anti-CD256 / APRIL (310-323) Antibody 50 Вµg 732 € acr human
AP02044SU-N anti-CD256 / APRIL Antibody 0,1 ml 775 € acr human
AP02044SU-S anti-CD256 / APRIL Antibody 20 Вµl 297 € acr human
AP06646PU-N anti-CD256 / APRIL Antibody 0,1 mg 558 € acr human
AR20000PU-N anti-CD256 / APRIL Antibody 10 Вµg 384 € acr human
AR20000PU-S anti-CD256 / APRIL Antibody 2 Вµg 253 € acr human
C10195-1 anti-CD256 / APRIL Antibody 50 Вµg 347 € acr human
C10195-2 anti-CD256 / APRIL Antibody 0,1 mg 500 € acr human
CPA2318-100ul anti-CD256 / APRIL Antibody 0,1 ml 442 € acr human
CPA2318-200ul anti-CD256 / APRIL Antibody 0,2 ml 688 € acr human
CPA2318-30ul anti-CD256 / APRIL Antibody 30 Вµl 326 € acr human
PA270 anti-CD256 / APRIL Antibody 5 Вµg 253 € acr human
PA270X anti-CD256 / APRIL Antibody 20 Вµg 384 € acr human
PP1200B1 anti-CD256 / APRIL Antibody 25 Вµg 384 € acr human
PP1200B2 anti-CD256 / APRIL Antibody 50 Вµg 543 € acr human
PP1200P1 anti-CD256 / APRIL Antibody 50 Вµg 384 € acr human
PP1200P2 anti-CD256 / APRIL Antibody 0,1 mg 543 € acr human
SP2133P anti-CD256 / APRIL Antibody 0,1 mg 529 € acr human
AP30074CP-N anti-CD256 / APRIL Control Peptide Antibody 50 Вµg 282 € acr human
AP30075CP-N anti-CD256 / APRIL Control Peptide Antibody 50 Вµg 282 € acr human