| Category: |
Antibody |
| Concentration: |
2ml sterile DI water, 5mg/ml if reconstituted with 0 |
| Form: |
Antigen affinity purified |
| Conjugation: |
Unconjugated |
| Clone: |
Polyclonal antibody |
| Recognised antigen: |
APRIL |
| Host animal: |
Rabbit (Oryctolagus cuniculus) |
| Clonality: |
Polyclonal (rabbit origin) |
| Species reactivity: |
Due to limited knowledge and inability to test the antibody against all known species, we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens) |
| Tested applications: |
ELISA, WB |
| Recommended dilutions: |
1-0, 1-0, 5ug/ml, 5ug/ml, ELISA : 0, Western blot: 0 |
| Notes: |
Optimal dilution of the APRIL antibody should be determined by the researcher |
| Intented use: |
This APRIL antibodyis to be used only for research purposes and not for diagnostics |
| Uniprot #: |
O75888 |
| Purity: |
Antigen affinity |
| Description: |
Alternative splicing results in multiple transcript variants, And this protein is a ligand for TNFRSF17/BCMA, In vitro experiments suggested that this protein may be able to induce apoptosis through its interaction with other TNF receptor family proteins such as TNFRSF6/FAS and TNFRSF14/HVEM, Some transcripts that skip the last exon of the upstream gene (TNFSF12) and continue into the second exon of this gene have been identified, TNFSF12-TNFSF13, The protein encoded by this gene is a member of the tumor necrosis factor (TNF) ligand family, This protein and its receptor are both found to be important for B cell development, a member of the TNF receptor family, also known as tumor necrosis factor ligand superfamily member 13 (TNFSF13), is a protein of the TNF superfamily recognized by the cell surface receptor TACI, such read-through transcripts are contained in GeneID 407977, A proliferation-inducing ligand (APRIL) |
| Immunogen: |
Amino acids PINATSKDDSDVTEVMWQPALRRGRGLQAQ of human APRIL were used as the immunogen for the APRIL antibody |
| Storage: |
Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the APRIL antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term |
| Properties: |
C, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24° |
| Gene target: |
APRIL |
| Short name: |
APRIL Antibody |
| Technique: |
antibodies against human proteins, antibodies for, Antibody |
| Alternative name: |
APRIL (Antibody to) |
| Alternative technique: |
antibodies |
| Identity: |
11928 |
| Gene: |
TNFSF13 |
More about : TNFSF13 |
| Long gene name: |
tumor necrosis factor superfamily member 13 |
| Synonyms gene name: |
member 13 , tumor necrosis factor (ligand) superfamily |
| Synonyms: |
APRIL CD256 |
| Locus: |
17p13, 1 |
| Discovery year: |
1998-12-04 |
| GenBank acession: |
AF046888 |
| Entrez gene record: |
8741 |
| Pubmed identfication: |
9743536 |
| RefSeq identity: |
NM_003808 |
| Classification: |
Tumor necrosis factor superfamily CD molecules |
| Havana BLAST/BLAT: |
OTTHUMG00000108145 |