| Category: |
Antibody |
| Concentration: |
2ml sterile DI water, 5mg/ml if reconstituted with 0 |
| Form: |
Antigen affinity purified |
| Conjugation: |
Unconjugated |
| Clone: |
Polyclonal antibody |
| Recognised antigen: |
Gremlin 1 |
| Host animal: |
Rabbit (Oryctolagus cuniculus) |
| Clonality: |
Polyclonal (rabbit origin) |
| Species reactivity: |
Due to limited knowledge and inability to test the antibody against all known species, Rat , we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens) |
| Tested applications: |
WB |
| Recommended dilutions: |
1-0, 5ug/ml, Western blot: 0 |
| Notes: |
Optimal dilution of the Gremlin 1 antibody should be determined by the researcher |
| Intented use: |
This Gremlin 1 antibodyis to be used only for research purposes and not for diagnostics |
| Uniprot #: |
O60565 |
| Purity: |
Antigen affinity |
| Description: |
184 amino acid glycoprotein part of the DAN family and is a cysteine knot-secreted protein, And Gremlin is expressed in osteoblasts and opposes BMP effects on osteoblastic differentiation and function in vitro, BMP-4, Gremlin 1 (GREM 1) is known for its antagonistic reaction with BMPs in the TGF beta signaling pathway, Gremlin 1 and its binding protein YWHAH could be good targets for developing diagnostic and therapeutic strategies against human cancers, Gremlin 1 may play an oncogenic role especially in carcinomas of the uterine cervix, Inhibition by grem 1 of BMPs in mice allow the expression of fibroblast growth factors (FGFs) 4 and 8 and Sonic hedgehog (SHH) which are necessary for proper limb development, Over-expressed gremlin 1 functions by interaction with YWHAH (Its binding site for gremlin 1 was located between residues 61-80 and gremlin 1 binding site for YWHAH was found to be located between residues 1-67), Skeletal cells synthesize bone morphogenetic proteins (BMPs) and BMP antagonists, Therefore, This gene inhibits BMP-2, also known as Drm, and BMP-7, and sarcoma, breast, colon, is a highly conserved 20, kidney, lung, ovary, pancreas, 7-kDa, Gremlin |
| Immunogen: |
Amino acids TMMVTLNCPELQPPTKKKRVTRVKQCRCISIDLD of human Gremlin 1 were used as the immunogen for the Gremlin 1 antibody |
| Storage: |
Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the Gremlin 1 antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term |
| Properties: |
C, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24° |
| Gene target: |
Gremlin 1 |
| Short name: |
Gremlin 1 Antibody |
| Technique: |
antibodies against human proteins, antibodies for, Antibody |
| Alternative name: |
Gremlin 1 (Antibody to) |
| Alternative technique: |
antibodies |
| Identity: |
20574 |
| Gene: |
CRAC1 |
More about : CRAC1 |
| Long gene name: |
DAN family BMP antagonist , gremlin 1 |
| Synonyms gene: |
CKTSF1B1 |
| Synonyms gene name: |
BMP antagonist 1 gremlin 1, cysteine knot superfamily, cysteine knot superfamily 1, homolog (Xenopus laevis) gremlin 1 colorectal adenoma and carcinoma 1 |
| Synonyms: |
DRM gremlin DAND2 HMPS GREM1 |
| Locus: |
15q13, 3 |
| Discovery year: |
1999-12-02 |
| Entrez gene record: |
26585 |
| Pubmed identfication: |
9660951 10026205 22561515 27385727 |
| RefSeq identity: |
NM_013372 |
| Classification: |
DAN family |
| Havana BLAST/BLAT: |
OTTHUMG00000129319 |