Gremlin 1 Antibody

Contact us
Catalog number: R31825
Price: 1109 €
Supplier: acr
Product name: Gremlin 1 Antibody
Quantity: 0,5 mg
Other quantities: 0.1ml 263€
Related search:

More details :

Category: Antibody
Concentration: 2ml sterile DI water, 5mg/ml if reconstituted with 0
Form: Antigen affinity purified
Conjugation: Unconjugated
Clone: Polyclonal antibody
Recognised antigen: Gremlin 1
Host animal: Rabbit (Oryctolagus cuniculus)
Clonality: Polyclonal (rabbit origin)
Species reactivity: Due to limited knowledge and inability to test the antibody against all known species, Rat , we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens)
Tested applications: WB
Recommended dilutions: 1-0, 5ug/ml, Western blot: 0
Notes: Optimal dilution of the Gremlin 1 antibody should be determined by the researcher
Intented use: This Gremlin 1 antibodyis to be used only for research purposes and not for diagnostics
Uniprot #: O60565
Purity: Antigen affinity
Description: 184 amino acid glycoprotein part of the DAN family and is a cysteine knot-secreted protein, And Gremlin is expressed in osteoblasts and opposes BMP effects on osteoblastic differentiation and function in vitro, BMP-4, Gremlin 1 (GREM 1) is known for its antagonistic reaction with BMPs in the TGF beta signaling pathway, Gremlin 1 and its binding protein YWHAH could be good targets for developing diagnostic and therapeutic strategies against human cancers, Gremlin 1 may play an oncogenic role especially in carcinomas of the uterine cervix, Inhibition by grem 1 of BMPs in mice allow the expression of fibroblast growth factors (FGFs) 4 and 8 and Sonic hedgehog (SHH) which are necessary for proper limb development, Over-expressed gremlin 1 functions by interaction with YWHAH (Its binding site for gremlin 1 was located between residues 61-80 and gremlin 1 binding site for YWHAH was found to be located between residues 1-67), Skeletal cells synthesize bone morphogenetic proteins (BMPs) and BMP antagonists, Therefore, This gene inhibits BMP-2, also known as Drm, and BMP-7, and sarcoma, breast, colon, is a highly conserved 20, kidney, lung, ovary, pancreas, 7-kDa, Gremlin
Immunogen: Amino acids TMMVTLNCPELQPPTKKKRVTRVKQCRCISIDLD of human Gremlin 1 were used as the immunogen for the Gremlin 1 antibody
Storage: Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the Gremlin 1 antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term
Properties: C, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24°
Gene target: Gremlin 1
Short name: Gremlin 1 Antibody
Technique: antibodies against human proteins, antibodies for, Antibody
Alternative name: Gremlin 1 (Antibody to)
Alternative technique: antibodies
Identity: 20574
Gene: CRAC1 | More about : CRAC1
Long gene name: DAN family BMP antagonist , gremlin 1
Synonyms gene: CKTSF1B1
Synonyms gene name: BMP antagonist 1 gremlin 1, cysteine knot superfamily, cysteine knot superfamily 1, homolog (Xenopus laevis) gremlin 1 colorectal adenoma and carcinoma 1
Synonyms: DRM gremlin DAND2 HMPS GREM1
Locus: 15q13, 3
Discovery year: 1999-12-02
Entrez gene record: 26585
Pubmed identfication: 9660951 10026205 22561515 27385727
RefSeq identity: NM_013372
Classification: DAN family
Havana BLAST/BLAT: OTTHUMG00000129319

Related Products :

GWB-BBP199 Polyclonal antibody to or anti- Gremlin 1 antibody 1 vial 463 € genways human
abx128902 Anti-Gremlin 1 Antibody 100 μg 514 € abbex human
AR50785PU-N anti-Gremlin-1 / GREM1 (25-184, His-tag) Antibody 0,5 mg 1109 € acr human
AR50785PU-S anti-Gremlin-1 / GREM1 (25-184, His-tag) Antibody 0,1 mg 485 € acr human
AP26028PU-L anti-Gremlin-1 / GREM1 Antibody 0,2 mg 587 € acr human
AP26028PU-N anti-Gremlin-1 / GREM1 Antibody 0,1 mg 442 € acr human
AP26029PU-L anti-Gremlin-1 / GREM1 Antibody 0,2 mg 587 € acr human
AP26029PU-N anti-Gremlin-1 / GREM1 Antibody 0,1 mg 442 € acr human
AR26007PU-N anti-Gremlin-1 / GREM1 Antibody 50 Вµg 456 € acr human
AR26008PU-N anti-Gremlin-1 / GREM1 Antibody 50 Вµg 456 € acr human
AR31096PU-N anti-Gremlin-1 / GREM1 Antibody 50 Вµg 384 € acr human
AR31096PU-S anti-Gremlin-1 / GREM1 Antibody 10 Вµg 253 € acr human
AR31150PU-N anti-Gremlin-1 / GREM1 Antibody 25 Вµg 427 € acr human
GENTAUR-58bdc2a34d617 Anti- Gremlin 1 (GREM1) Antibody 100ug 531 € MBS Polyclonals human
GENTAUR-58bdc3f74cc01 Anti- Gremlin 1 (GREM1) Antibody 100ug 564 € MBS Polyclonals human
GENTAUR-58bdcba9e050e Anti- Gremlin 1 (GREM1) Antibody 50ug 382 € MBS Polyclonals human
GENTAUR-58bdcbaa35738 Anti- Gremlin 1 (GREM1) Antibody 100ug 503 € MBS Polyclonals human
GENTAUR-58bdcd1019a20 Anti- Gremlin 1 (GREM1) Antibody 50ug 376 € MBS Polyclonals human
GENTAUR-58bdcd1054cf1 Anti- Gremlin 1 (GREM1) Antibody 100ug 492 € MBS Polyclonals human
GENTAUR-58bdcdfaa265d Anti- Gremlin 1 (GREM1) Antibody 50ug 398 € MBS Polyclonals human
GENTAUR-58bdcdfb1350f Anti- Gremlin 1 (GREM1) Antibody 100ug 525 € MBS Polyclonals human
GENTAUR-58bdd02cee1e8 Anti- Gremlin 1 (GREM1) Antibody 100ug 542 € MBS Polyclonals human
GENTAUR-58bdd457bfa8d Anti- Gremlin 1 (GREM1) Antibody 100ug 603 € MBS Polyclonals human
GENTAUR-58bdd81a1f926 Anti- Gremlin 1 (GREM1) Antibody 100ug 575 € MBS Polyclonals human
GENTAUR-58bddd4cb45ff Anti- Gremlin 1 (GREM1) Antibody 100ug 564 € MBS Polyclonals human
AP13096PU-N anti-Gremlin-1 / GREM1 (C-term) Antibody 0,4 ml 587 € acr human
AP23414PU-N anti-Gremlin-1 / GREM1 (C-term) Antibody 0,1 mg 543 € acr human
AP51947PU-N anti-Gremlin-1 / GREM1 (C-term) Antibody 0,4 ml 587 € acr human
abx129259 Anti-Gremlin 2 Antibody 50 μg 441 € abbex human
AR50873PU-N anti-Gremlin-2 / GREM2 (22-168, His-tag) Antibody 0,5 mg 1109 € acr human