| Category: |
Antibody |
| Concentration: |
2ml sterile DI water, 5mg/ml if reconstituted with 0 |
| Form: |
Antigen affinity purified |
| Conjugation: |
Unconjugated |
| Clone: |
Polyclonal antibody |
| Recognised antigen: |
AMPK beta 2 / PRKAB2 |
| Host animal: |
Rabbit (Oryctolagus cuniculus) |
| Clonality: |
Polyclonal (rabbit origin) |
| Species reactivity: |
Due to limited knowledge and inability to test the antibody against all known species, Mouse (Mus musculus), Rat , we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens) |
| Tested applications: |
IHC-P, WB |
| Recommended dilutions: |
1-0, 5-1ug/ml, 5ug/ml, IHC (Paraffin): 0, Western blot: 0 |
| Notes: |
Optimal dilution of the PRKAB2 antibody should be determined by the researcher |
| Intented use: |
This PRKAB2 antibodyis to be used only for research purposes and not for diagnostics |
| Uniprot #: |
O43741 |
| Purity: |
Antigen affinity |
| Description: |
AMPK is a heterotrimer consisting of an alpha catalytic subunit, AMPK is activated, In response to cellular metabolic stresses, It is an important energy-sensing enzyme that monitors cellular energy status, It is highly expressed in skeletal muscle and thus may have tissue-specific roles, Multiple alternatively spliced transcript variants have been found for this gene, The protein encoded by this gene is a regulatory subunit of the AMP-activated protein kinase (AMPK), This subunit may be a positive regulator of AMPK activity, and non-catalytic beta and gamma subunits, and thus phosphorylates and inactivates acetyl-CoA carboxylase (ACC) and beta-hydroxy beta-methylglutaryl-CoA reductase (HMGCR), key enzymes involved in regulating de novo biosynthesis of fatty acid and cholesterol, 5'-AMP-activated protein kinase subunit beta-2 is an enzyme that in humans is encoded by the PRKAB2 gene |
| Immunogen: |
Amino acids DKEFVSWQQDLEDSVKPTQQARPTVIRWSEGGKE of human AMPK beta 2 were used as the immunogen for the PRKAB2 antibody |
| Storage: |
Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the PRKAB2 antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term |
| Localization: |
Cytoplasmic |
| Properties: |
C, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24° |
| Gene target: |
AMPK beta 2 / PRKAB2 |
| Short name: |
AMPK beta 2 Antibody / PRKAB2 |
| Technique: |
antibodies against human proteins, antibodies for, Antibody |
| Alternative name: |
AMP-activated, b 2 non-catalytic subunit, AMPK b 2 (Antibody to) / protein phosphorylation catalyst |
| Alternative technique: |
antibodies |
| Alternative to gene target: |
AMP-activated, PRKAB2 and IDBG-101806 and ENSG00000131791 and 5565, PRKAB2 and IDBG-633860 and ENSBTAG00000014387 and 512665, Prkab2 and IDBG-177135 and ENSMUSG00000038205 and 108097, beta 2 non-catalytic subunit, identical protein binding, nuclei, this GO :0004679 and AMP-activated protein kinase activity and molecular function this GO :0005515 and protein binding and molecular function this GO :0005654 and nucleoplasm and cellular component this GO :0005829 and cytosol and cellular component this GO :0006112 and energy reserve metabolic process and biological process this GO :0006468 and protein phosphorylation and biological process this GO :0006633 and fatty acid biosynthetic process and biological process this GO :0006853 and carnitine shuttle and biological process this GO :0007050 and cell cycle arrest and biological process this GO :0007165 and signal transduction and biological process this GO :0008286 and insulin receptor signaling pathway and biological process this GO :0031588 and AMP-activated protein kinase complex and cellular component this GO :0042304 and regulation of fatty acid biosynthetic process and biological process this GO :0042802 and identical protein binding and molecular function this GO :0044255 and cellular lipid metabolic process and biological process this GO :0044281 and small molecule metabolic process and biological process this GO :0061024 and membrane organization and biological process, this GO :0004679 : AMP-activated protein kinase activity, this GO :0004679 : AMP-activated protein kinase activity and also this GO :0005515 : protein binding and also this GO :0042802 : identical protein binding, this GO :0005515 : protein binding, this GO :0042802 : identical protein binding, protein kinase |
| Identity: |
9379 |
| Gene: |
PRKAB2 |
More about : PRKAB2 |
| Long gene name: |
protein kinase AMP-activated non-catalytic subunit beta 2 |
| Synonyms gene name: |
AMP-activated, beta 2 non-catalytic subunit , protein kinase |
| Synonyms name: |
AMPK beta 2 |
| Locus: |
1q21, 1 |
| Discovery year: |
1997-05-09 |
| GenBank acession: |
BC053610 |
| Entrez gene record: |
5565 |
| Pubmed identfication: |
8557660 |
| RefSeq identity: |
NM_005399 |
| Havana BLAST/BLAT: |
OTTHUMG00000014032 |