AMPK beta 2 Antibody / PRKAB2

Contact us
Catalog number: R31820
Price: 558 €
Supplier: MBS Polyclonals
Product name: AMPK beta 2 Antibody / PRKAB2
Quantity: 0.2 mg
Related search:

More details :

Category: Antibody
Concentration: 2ml sterile DI water, 5mg/ml if reconstituted with 0
Form: Antigen affinity purified
Conjugation: Unconjugated
Clone: Polyclonal antibody
Recognised antigen: AMPK beta 2 / PRKAB2
Host animal: Rabbit (Oryctolagus cuniculus)
Clonality: Polyclonal (rabbit origin)
Species reactivity: Due to limited knowledge and inability to test the antibody against all known species, Mouse (Mus musculus), Rat , we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens)
Tested applications: IHC-P, WB
Recommended dilutions: 1-0, 5-1ug/ml, 5ug/ml, IHC (Paraffin): 0, Western blot: 0
Notes: Optimal dilution of the PRKAB2 antibody should be determined by the researcher
Intented use: This PRKAB2 antibodyis to be used only for research purposes and not for diagnostics
Uniprot #: O43741
Purity: Antigen affinity
Description: AMPK is a heterotrimer consisting of an alpha catalytic subunit, AMPK is activated, In response to cellular metabolic stresses, It is an important energy-sensing enzyme that monitors cellular energy status, It is highly expressed in skeletal muscle and thus may have tissue-specific roles, Multiple alternatively spliced transcript variants have been found for this gene, The protein encoded by this gene is a regulatory subunit of the AMP-activated protein kinase (AMPK), This subunit may be a positive regulator of AMPK activity, and non-catalytic beta and gamma subunits, and thus phosphorylates and inactivates acetyl-CoA carboxylase (ACC) and beta-hydroxy beta-methylglutaryl-CoA reductase (HMGCR), key enzymes involved in regulating de novo biosynthesis of fatty acid and cholesterol, 5'-AMP-activated protein kinase subunit beta-2 is an enzyme that in humans is encoded by the PRKAB2 gene
Immunogen: Amino acids DKEFVSWQQDLEDSVKPTQQARPTVIRWSEGGKE of human AMPK beta 2 were used as the immunogen for the PRKAB2 antibody
Storage: Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the PRKAB2 antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term
Localization: Cytoplasmic
Properties: C, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24°
Gene target: AMPK beta 2 / PRKAB2
Short name: AMPK beta 2 Antibody / PRKAB2
Technique: antibodies against human proteins, antibodies for, Antibody
Alternative name: AMP-activated, b 2 non-catalytic subunit, AMPK b 2 (Antibody to) / protein phosphorylation catalyst
Alternative technique: antibodies
Alternative to gene target: AMP-activated, PRKAB2 and IDBG-101806 and ENSG00000131791 and 5565, PRKAB2 and IDBG-633860 and ENSBTAG00000014387 and 512665, Prkab2 and IDBG-177135 and ENSMUSG00000038205 and 108097, beta 2 non-catalytic subunit, identical protein binding, nuclei, this GO :0004679 and AMP-activated protein kinase activity and molecular function this GO :0005515 and protein binding and molecular function this GO :0005654 and nucleoplasm and cellular component this GO :0005829 and cytosol and cellular component this GO :0006112 and energy reserve metabolic process and biological process this GO :0006468 and protein phosphorylation and biological process this GO :0006633 and fatty acid biosynthetic process and biological process this GO :0006853 and carnitine shuttle and biological process this GO :0007050 and cell cycle arrest and biological process this GO :0007165 and signal transduction and biological process this GO :0008286 and insulin receptor signaling pathway and biological process this GO :0031588 and AMP-activated protein kinase complex and cellular component this GO :0042304 and regulation of fatty acid biosynthetic process and biological process this GO :0042802 and identical protein binding and molecular function this GO :0044255 and cellular lipid metabolic process and biological process this GO :0044281 and small molecule metabolic process and biological process this GO :0061024 and membrane organization and biological process, this GO :0004679 : AMP-activated protein kinase activity, this GO :0004679 : AMP-activated protein kinase activity and also this GO :0005515 : protein binding and also this GO :0042802 : identical protein binding, this GO :0005515 : protein binding, this GO :0042802 : identical protein binding, protein kinase
Identity: 9379
Gene: PRKAB2 | More about : PRKAB2
Long gene name: protein kinase AMP-activated non-catalytic subunit beta 2
Synonyms gene name: AMP-activated, beta 2 non-catalytic subunit , protein kinase
Synonyms name: AMPK beta 2
Locus: 1q21, 1
Discovery year: 1997-05-09
GenBank acession: BC053610
Entrez gene record: 5565
Pubmed identfication: 8557660
RefSeq identity: NM_005399
Havana BLAST/BLAT: OTTHUMG00000014032

Related Products :

MBS624111 AMPK beta2, NT (5'-AMP-activated Protein Kinase Subunit beta-2, AMPK Subunit beta-2, PRKAB2) Antibody 200ul 603 € MBS Polyclonals_1 human
MBS622597 AMP Activated Protein Kinase gamma1 (AMPK gamma-1 Chain, AMPK Subunit gamma-1, AMPK gamma1, AMPK g1, AMPKg, 5'-AMP-activated Protein Kinase Subunit gamma-1, MGC8666, PRKAG1) Antibody 100ug 647 € MBS Polyclonals_1 human
MBS624349 AMPK beta, NT (5'-AMP-activated Protein Kinase Subunit beta-1, AMPK Subunit beta-1, AMPK, PRKAB1) Antibody 200ul 603 € MBS Polyclonals_1 human
MBS622720 AMP Activated Protein Kinase beta1 (AMPK beta-1 Chain, AMPK Subunit beta-1, AMPK b1, AMPKb, 5'-AMP-activated Protein Kinase Subunit beta-1, HAMPKb, MGC17785, PRKAB1) Antibody 100ug 647 € MBS Polyclonals_1 human
MBS620772 AMP Activated Protein Kinase alpha1 (AMPK Subunit alpha-1, AMPK a1, AMPKa1, 5'-AMP-activated Protein Kinase Catalytic Subunit alpha-1, AMPK1, AMPK, MGC33776, MGC57364, PRKAA1) Antibody 100ug 647 € MBS Polyclonals_1 human
MBS619057 AMP Activated Protein Kinase alpha2 (5'-AMP-activated Protein Kinase Catalytic Subunit alpha-2, AMPK alpha-2 Chain, AMPK Subunit alpha-2, AMPK a2, AMPK2, PRKAA2, PRKAA) Antibody 100ug 647 € MBS Polyclonals_1 human
MBS622473 AMP Activated Protein Kinase alpha2 (AMPK alpha-2 Chain, AMPK Subunit alpha-2, AMPK a2, 5'-AMP-activated Protein Kinase Catalytic Subunit alpha-2, AMPK2, PRKAA2, PRKAA) Antibody 100ug 647 € MBS Polyclonals_1 human
F50061-0.08ML AMPK beta 2 Antibody (PRKAB2) 0.08 ml 199 € NJS poly human
F50061-0.4ML AMPK beta 2 Antibody (PRKAB2) 0.4 ml 406 € NJS poly human
R31820 AMPK beta 2 Antibody / PRKAB2 0.1mg 406 € NJS poly human
AR50641PU-N anti-AMPK beta-2 chain / PRKAB2 (1-272, His-tag) Antibody 0,5 mg 1109 € acr human
AR50641PU-S anti-AMPK beta-2 chain / PRKAB2 (1-272, His-tag) Antibody 0,1 mg 485 € acr human
AP22970PU-N anti-AMPK beta-2 chain / PRKAB2 Antibody 50 Вµg 732 € acr human
CPA9235-100ul anti-AMPK beta-2 chain / PRKAB2 Antibody 0,1 ml 442 € acr human
CPA9235-200ul anti-AMPK beta-2 chain / PRKAB2 Antibody 0,2 ml 688 € acr human
CPA9235-30ul anti-AMPK beta-2 chain / PRKAB2 Antibody 30 Вµl 326 € acr human
AP13598PU-N anti-AMPK beta-2 chain / PRKAB2 (N-term) Antibody 0,4 ml 587 € acr human
MBS244198 Goat Polyclonal to Human PRKAB2 / AMPK Beta 2 Antibody 50ug 597 € MBS Polyclonals_1 human
MBS617100 AMP Activated Protein Kinase alpha1, phosphorylated (Ser485)/AMPKa2 (Ser491) (AMPK a1, AMPK a2) Antibody 100ul 603 € MBS Polyclonals_1 human
GENTAUR-58b38790bc067 Human 5'-AMP-activated protein kinase subunit beta-2 (PRKAB2) 100ug 1801 € MBS Recombinant Proteins human
GENTAUR-58b38790ee7fe Human 5'-AMP-activated protein kinase subunit beta-2 (PRKAB2) 1000ug 1801 € MBS Recombinant Proteins human
GENTAUR-58b387913d99d Human 5'-AMP-activated protein kinase subunit beta-2 (PRKAB2) 100ug 2310 € MBS Recombinant Proteins human
GENTAUR-58b3879170f70 Human 5'-AMP-activated protein kinase subunit beta-2 (PRKAB2) 1000ug 2310 € MBS Recombinant Proteins human
GENTAUR-58b445245cb52 Human 5'-AMP-activated protein kinase subunit beta-2 (PRKAB2) 100ug 1801 € MBS Recombinant Proteins human
GENTAUR-58b44524d95d2 Human 5'-AMP-activated protein kinase subunit beta-2 (PRKAB2) 1000ug 1801 € MBS Recombinant Proteins human
GENTAUR-58b4452561703 Human 5'-AMP-activated protein kinase subunit beta-2 (PRKAB2) 100ug 2310 € MBS Recombinant Proteins human
GENTAUR-58b44525ba43a Human 5'-AMP-activated protein kinase subunit beta-2 (PRKAB2) 1000ug 2310 € MBS Recombinant Proteins human
GENTAUR-58be46c5040a5 Anti- PRKAB2 Antibody 100ug 393 € MBS Polyclonals human
GENTAUR-58be53df5f864 Anti- PRKAB2 Antibody 50ug 304 € MBS Polyclonals human
GENTAUR-58be53df9304b Anti- PRKAB2 Antibody 0.2 mg 558 € MBS Polyclonals human