| Category: |
Antibody |
| Concentration: |
2ml sterile DI water, 5mg/ml if reconstituted with 0 |
| Form: |
Antigen affinity purified |
| Conjugation: |
Unconjugated |
| Clone: |
Polyclonal antibody |
| Recognised antigen: |
PDPK1 / 3-phosphoinositide-dependent protein kinase 1 |
| Host animal: |
Rabbit (Oryctolagus cuniculus) |
| Clonality: |
Polyclonal (rabbit origin) |
| Species reactivity: |
Due to limited knowledge and inability to test the antibody against all known species, Mouse (Mus musculus), Rat , we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens) |
| Tested applications: |
IHC-P, WB |
| Recommended dilutions: |
1-0, 5-1ug/ml, 5ug/ml, IHC (Paraffin): 0, Western blot: 0 |
| Notes: |
Optimal dilution of the PDPK1 antibody should be determined by the researcher |
| Intented use: |
This PDPK1 antibodyis to be used only for research purposes and not for diagnostics |
| Uniprot #: |
O15530 |
| Purity: |
Antigen affinity |
| Description: |
An important role for PDPK1 is in the signalling pathways activated by several growth factors and hormones including insulin signaling, Mice lacking PDPK1 die during early embryonic development, PDPK1 is a master kinase, S6K, SGK, indicating that this enzyme is critical for transmitting the growth-promoting signals necessary for normal mammalian development, which is crucial for the activation of AKT/PKB and many other AGC kinases including PKC, 3-phosphoinositide dependent protein kinase-1 is a protein which in humans is encoded by the PDPK1 gene |
| Immunogen: |
Amino acids YLMDPSGNAHKWCRKIQEVWRQRYQSHPDAAVQ of human PDPK1 were used as the immunogen for the PDPK1 antibody |
| Storage: |
Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the PDPK1 antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term |
| Localization: |
Cytoplasmic |
| Properties: |
C, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24° |
| Gene target: |
PDPK1 / 3-phosphoinositide-dependent protein kinase 1 |
| Short name: |
PDPK1 Antibody / 3-phosphoinositide-dependent protein kinase 1 |
| Technique: |
antibodies against human proteins, antibodies for, Antibody |
| Alternative name: |
PDPK1 (Antibody to) / 3-phosphoinositide-dependent protein phosphorylation catalyst 1 |
| Alternative technique: |
antibodies |
| Identity: |
8816 |
| Gene: |
PDPK1 |
More about : PDPK1 |
| Long gene name: |
3-phosphoinositide dependent protein kinase 1 |
| Synonyms: |
PDK1 |
| Synonyms name: |
PkB kinase |
| Locus: |
16p13, 3 |
| Discovery year: |
1998-03-23 |
| GenBank acession: |
AF017995 |
| Entrez gene record: |
5170 |
| Pubmed identfication: |
9094314 9445477 |
| Havana BLAST/BLAT: |
OTTHUMG00000128874 |