PDPK1 Antibody / 3-phosphoinositide-dependent protein kinase 1

Contact us
Catalog number: R31813
Price: 735 €
Supplier: MBS Polyclonals_1
Product name: PDPK1 Antibody / 3-phosphoinositide-dependent protein kinase 1
Quantity: 100ug
Related search:

More details :

Category: Antibody
Concentration: 2ml sterile DI water, 5mg/ml if reconstituted with 0
Form: Antigen affinity purified
Conjugation: Unconjugated
Clone: Polyclonal antibody
Recognised antigen: PDPK1 / 3-phosphoinositide-dependent protein kinase 1
Host animal: Rabbit (Oryctolagus cuniculus)
Clonality: Polyclonal (rabbit origin)
Species reactivity: Due to limited knowledge and inability to test the antibody against all known species, Mouse (Mus musculus), Rat , we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens)
Tested applications: IHC-P, WB
Recommended dilutions: 1-0, 5-1ug/ml, 5ug/ml, IHC (Paraffin): 0, Western blot: 0
Notes: Optimal dilution of the PDPK1 antibody should be determined by the researcher
Intented use: This PDPK1 antibodyis to be used only for research purposes and not for diagnostics
Uniprot #: O15530
Purity: Antigen affinity
Description: An important role for PDPK1 is in the signalling pathways activated by several growth factors and hormones including insulin signaling, Mice lacking PDPK1 die during early embryonic development, PDPK1 is a master kinase, S6K, SGK, indicating that this enzyme is critical for transmitting the growth-promoting signals necessary for normal mammalian development, which is crucial for the activation of AKT/PKB and many other AGC kinases including PKC, 3-phosphoinositide dependent protein kinase-1 is a protein which in humans is encoded by the PDPK1 gene
Immunogen: Amino acids YLMDPSGNAHKWCRKIQEVWRQRYQSHPDAAVQ of human PDPK1 were used as the immunogen for the PDPK1 antibody
Storage: Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the PDPK1 antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term
Localization: Cytoplasmic
Properties: C, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24°
Gene target: PDPK1 / 3-phosphoinositide-dependent protein kinase 1
Short name: PDPK1 Antibody / 3-phosphoinositide-dependent protein kinase 1
Technique: antibodies against human proteins, antibodies for, Antibody
Alternative name: PDPK1 (Antibody to) / 3-phosphoinositide-dependent protein phosphorylation catalyst 1
Alternative technique: antibodies
Identity: 8816
Gene: PDPK1 | More about : PDPK1
Long gene name: 3-phosphoinositide dependent protein kinase 1
Synonyms: PDK1
Synonyms name: PkB kinase
Locus: 16p13, 3
Discovery year: 1998-03-23
GenBank acession: AF017995
Entrez gene record: 5170
Pubmed identfication: 9094314 9445477
Havana BLAST/BLAT: OTTHUMG00000128874

Related Products :

MBS610330 PDK1, phosphorylated (Ser241 (PDPK1, PI-P3 Dependent Kinase, 3a Phosphoinositide dependent Protein Kinase 1) Antibody 100ul 603 € MBS Polyclonals_1 human
GWB-A12E70 3-Phosphoinositide Dependent protein Kinase 1 (PDPK1) Rabbit antibody to or anti-Human Polyclonal (pSer241) antibody 1 vial 602 € genways human
GENTAUR-58bdcf4e715bf Anti- Phosphoinositide Dependent Protein Kinase 1 (PDPK1) Antibody 100ug 492 € MBS Polyclonals human
GENTAUR-58bdcf4edaba5 Anti- Phosphoinositide Dependent Protein Kinase 1 (PDPK1) Antibody 50ug 376 € MBS Polyclonals human
GENTAUR-58bdd33a7eae3 Anti- Phosphoinositide Dependent Protein Kinase 1 (PDPK1) Antibody 100ug 525 € MBS Polyclonals human
GENTAUR-58bdd53d49c89 Anti- Phosphoinositide Dependent Protein Kinase 1 (PDPK1) Antibody 100ug 564 € MBS Polyclonals human
R31813 PDPK1 Antibody / 3-phosphoinositide-dependent protein kinase 1 0.1mg 406 € NJS poly human
AE28134RA-48 ELISA test for Rat 3-phosphoinositide-dependent protein kinase 1 (PDPK1) 1x plate of 48 wells 373 € abebio rat
GENTAUR-58bb92e9ef486 Human 3-phosphoinositide-dependent protein kinase 1 (PDPK1) 100ug 2525 € MBS Recombinant Proteins human
GENTAUR-58bb92ea491e0 Human 3-phosphoinositide-dependent protein kinase 1 (PDPK1) 1000ug 2525 € MBS Recombinant Proteins human
GENTAUR-58bb92ea96878 Human 3-phosphoinositide-dependent protein kinase 1 (PDPK1) 100ug 3039 € MBS Recombinant Proteins human
GENTAUR-58bb92ead0477 Human 3-phosphoinositide-dependent protein kinase 1 (PDPK1) 1000ug 3039 € MBS Recombinant Proteins human
DL-PDPK1-Mu Mouse Phosphoinositide Dependent Protein Kinase 1 PDPK1 ELISA Kit 96T 921 € DL elisas mouse
MBS623897 PDPK1, phosphorylated Ser396 (3-phosphoinositide Dependent Protein Kinase-1, hPDK1, PDK1) 200ul 603 € MBS Polyclonals_1 human
EKU06604 Phosphoinositide Dependent Protein Kinase 1 (PDPK1) ELISA kit 1 plate of 96 wells 844 € Biomatik ELISA kits human
GENTAUR-58b8c40488acf Rat 3-phosphoinositide-dependent protein kinase 1 (Pdpk1) 100ug 2536 € MBS Recombinant Proteins rat
GENTAUR-58b8c404e2173 Rat 3-phosphoinositide-dependent protein kinase 1 (Pdpk1) 1000ug 2536 € MBS Recombinant Proteins rat
GENTAUR-58b8c40537648 Rat 3-phosphoinositide-dependent protein kinase 1 (Pdpk1) 100ug 3050 € MBS Recombinant Proteins rat
GENTAUR-58b8c4059008b Rat 3-phosphoinositide-dependent protein kinase 1 (Pdpk1) 1000ug 3050 € MBS Recombinant Proteins rat
GENTAUR-58b9c4b2127a0 Rat 3-phosphoinositide-dependent protein kinase 1 (Pdpk1) 100ug 2536 € MBS Recombinant Proteins rat
GENTAUR-58b9c4b26ce7d Rat 3-phosphoinositide-dependent protein kinase 1 (Pdpk1) 1000ug 2536 € MBS Recombinant Proteins rat
GENTAUR-58b9c4b2dac58 Rat 3-phosphoinositide-dependent protein kinase 1 (Pdpk1) 100ug 3050 € MBS Recombinant Proteins rat
GENTAUR-58b9c4b33eec5 Rat 3-phosphoinositide-dependent protein kinase 1 (Pdpk1) 1000ug 3050 € MBS Recombinant Proteins rat
AE28134RA Rat 3-phosphoinositide-dependent protein kinase 1 (PDPK1) ELISA Kit 48 wells plate 480 € ab-elisa elisas rat
AE28134RA-96 Rat 3-phosphoinositide-dependent protein kinase 1 (PDPK1) ELISA Kit 1x plate of 96 wells 612 € abebio rat
MBS622372 Phosphoinositide 3 Kinase, p55 gamma (PI-3 Kinase p55 gamma, Phosphoinositide-3-kinase Regulatory Subunit 3 (p55, gamma), PIK3R3) Antibody 100ug 774 € MBS Polyclonals_1 human
MBS622094 Phosphoinositide 3 Kinase, p110 beta (Phosphoinositide-3-kinase Catalytic beta Polypeptide, Phosphatidylinositol-4,5-bisphosphate 3-kinase Catalytic Subunit beta Isoform, Phosphatidylinositol-4,5-bisphosphate 3-kinase 110kD Catalytic Subunit beta, PtdIns- Antibody 100ug 647 € MBS Polyclonals_1 human
MBS624580 PIK3C2A, NT (Phosphoinositide-3-kinase Class 2 alpha Polypeptide, Phosphoinositide 3-kinase-C2-alpha, Phosphatidylinositol-4-phosphate 3-kinase C2 Domain-containing Subunit alpha, PI3K-C2-alpha, PI3-K-C2(alpha), PI3-K-C2A, PtdIns-3-kinase C2 Subunit alpha Antibody 200ul 597 € MBS Polyclonals_1 human
MA10045MO Phosphoinositide Dependent Protein Kinase 1 antibody 100ug 705 € AbELISA Antibodies human
MBS622298 Hematopoietic Progenitor Kinase 1 (HPK1, Mitogen-activated Protein Kinase Kinase Kinase Kinase 1, MAP4K1, MAPK/ERK Kinase Kinase Kinase 1, MEK Kinase Kinase 1, MEKKK 1) Antibody 100ug 735 € MBS Polyclonals_1 human