CLOCK Antibody

Contact us
Catalog number: R31811
Price: 406 €
Supplier: NJS poly
Product name: CLOCK Antibody
Quantity: 0.1mg
Other quantities: 0.1mg 406€ 1 vial 521€ 100ug 746€ 100ul 597€ 50ug 525€
Related search:

More details :

Category: Antibody
Concentration: 2ml sterile DI water, 5mg/ml if reconstituted with 0
Form: Antigen affinity purified
Conjugation: Unconjugated
Clone: Polyclonal antibody
Recognised antigen: CLOCK
Host animal: Rabbit (Oryctolagus cuniculus)
Clonality: Polyclonal (rabbit origin)
Species reactivity: Due to limited knowledge and inability to test the antibody against all known species, Mouse (Mus musculus), Rat , we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens)
Tested applications: IHC-P, WB
Recommended dilutions: 1-0, 5-1ug/ml, 5ug/ml, IHC (Paraffin): 0, Western blot: 0
Notes: Optimal dilution of the CLOCK antibody should be determined by the researcher
Intented use: This CLOCK antibodyis to be used only for research purposes and not for diagnostics
Uniprot #: O15516
Purity: Antigen affinity
Description: Alternative splicing results in multiple transcript variants, And the encoded protein forms a heterodimer with ARNTL (BMAL1) that binds E-box enhancer elements upstream of Period (PER1, CRY2) genes and activates transcription of these genes, PER and CRY proteins heterodimerize and repress their own transcription by interacting in a feedback loop with CLOCK/ARNTL complexes, PER2, PER3) and Cryptochrome (CRY1, Polymorphisms in this gene may be associated with behavioral changes in certain populations and with obesity and metabolic syndrome, The protein encoded by this gene plays a central role in the regulation of circadian rhythms, This protein encodes a transcription factor of the basic helix-loop-helix (bHLH) family and contains DNA binding histone acetyltransferase activity, CLOCK (Circadian Locomotor Output Cycles Kaput) is also known as KAT13D
Immunogen: Amino acids QKSIDFLRKHKEITAQSDASEIRQDWKPTFLSNEE of human CLOCK were used as the immunogen for the CLOCK antibody
Storage: Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the CLOCK antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term
Localization: cytoplasmic, Nuclear
Properties: C, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24°
Gene target: CLOCK
Short name: CLOCK Antibody
Technique: antibodies against human proteins, antibodies for, Antibody
Alternative name: CLOCK (Antibody to)
Alternative technique: antibodies
Identity: 2082
Gene: CLOCK | More about : CLOCK
Long gene name: clock circadian regulator
Synonyms gene name: clock (mouse) homolog clock homolog (mouse)
Synonyms: KIAA0334 KAT13D bHLHe8
Locus: 4q12
Discovery year: 1999-04-19
GenBank acession: AF011568
Entrez gene record: 9575
Pubmed identfication: 10198158
RefSeq identity: NM_004898
Classification: Basic helix-loop-helix proteins Lysine acetyltransferases
Havana BLAST/BLAT: OTTHUMG00000102141

Related Products :

abx572695 Anti-Human Clock Homolog (CLOCK) ELISA Kit 96 tests 847 € abbex human
EKU03219 Clock Homolog (CLOCK) ELISA kit 1 plate of 96 wells 899 € Biomatik ELISA kits human
DL-CLOCK-Hu Human Clock Homolog CLOCK ELISA Kit 96T 974 € DL elisas human
MBS617744 Period Clock Protein 1 (Period 1, Period-1, PER1, Period Circadian Protein Homolog 1, Period Drosophila Homolog of, Period Homolog 1, Circadian Clock Protein PERIOD1, Circadian Clock Protein PERIOD-1, Circadian Pacemaker Protein RIGUI, HGNC:8845, hPER, hP Antibody 200ul 735 € MBS Polyclonals_1 drosophila
A03C0350 anti-Clock Antibody 200ug (50ug, 100ug available) 465 € Bluegen antibodies human
AM06433SU-N anti-CLOCK Antibody 0,1 ml 572 € acr human
AP06636PU-N anti-CLOCK Antibody 0,1 mg 558 € acr human
C10086-1 anti-CLOCK Antibody 50 Вµg 347 € acr human
C10086-2 anti-CLOCK Antibody 0,1 mg 500 € acr human
GENTAUR-58be04cb3e933 Anti- CLOCK Antibody 0.12 ml 348 € MBS Polyclonals human
GENTAUR-58be04cc08b2a Anti- CLOCK Antibody 0.06 ml 265 € MBS Polyclonals human
GENTAUR-58be136980be7 Anti- CLOCK Antibody 0.06 ml 265 € MBS Polyclonals human
GENTAUR-58be1369d96e7 Anti- CLOCK Antibody 0.12 ml 348 € MBS Polyclonals human
GENTAUR-58be41135593d Anti- CLOCK Antibody 100ug 393 € MBS Polyclonals human
GENTAUR-58be48be889f0 Anti- Clock Antibody 100ug 370 € MBS Polyclonals human
GENTAUR-58be56919016b Anti- CLOCK Antibody 0.2 mg 663 € MBS Polyclonals human
GENTAUR-58be5691c4b08 Anti- CLOCK Antibody 50ug 365 € MBS Polyclonals human
GENTAUR-58be57228b594 Anti- CLOCK Antibody 100ug 387 € MBS Polyclonals human
GENTAUR-58be572326260 Anti- CLOCK Antibody 0.2 mg 558 € MBS Polyclonals human
GENTAUR-58be572382259 Anti- CLOCK Antibody 50ug 304 € MBS Polyclonals human
abx146760 Anti-Clock Antibody 200 μg 369 € abbex human
AP14237PU-N anti-CLOCK (Center) Antibody 0,4 ml 587 € acr human
GENTAUR-58be2b31d4ee6 CLOCK antibody 100ul 431 € MBS mono human
GENTAUR-58be414be4660 CLOCK Antibody 100ug 370 € MBS mono human
GWB-ML668B CLOCK antibody 1 vial 521 € genways human
MBS616924 CLOCK Antibody 100ul 597 € MBS Polyclonals_1 human
MBS617613 Clock Antibody 50ug 525 € MBS Polyclonals_1 human
MBS620783 Clock Antibody 100ug 564 € MBS Polyclonals_1 human
R31811 CLOCK Antibody 0.1mg 406 € NJS poly human
R33663-100UG CLOCK Antibody 0.1mg 406 € NJS poly human