| Category: |
Antibody |
| Concentration: |
2ml sterile DI water, 5mg/ml if reconstituted with 0 |
| Form: |
Antigen affinity purified |
| Conjugation: |
Unconjugated |
| Clone: |
Polyclonal antibody |
| Recognised antigen: |
CLOCK |
| Host animal: |
Rabbit (Oryctolagus cuniculus) |
| Clonality: |
Polyclonal (rabbit origin) |
| Species reactivity: |
Due to limited knowledge and inability to test the antibody against all known species, Mouse (Mus musculus), Rat , we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens) |
| Tested applications: |
IHC-P, WB |
| Recommended dilutions: |
1-0, 5-1ug/ml, 5ug/ml, IHC (Paraffin): 0, Western blot: 0 |
| Notes: |
Optimal dilution of the CLOCK antibody should be determined by the researcher |
| Intented use: |
This CLOCK antibodyis to be used only for research purposes and not for diagnostics |
| Uniprot #: |
O15516 |
| Purity: |
Antigen affinity |
| Description: |
Alternative splicing results in multiple transcript variants, And the encoded protein forms a heterodimer with ARNTL (BMAL1) that binds E-box enhancer elements upstream of Period (PER1, CRY2) genes and activates transcription of these genes, PER and CRY proteins heterodimerize and repress their own transcription by interacting in a feedback loop with CLOCK/ARNTL complexes, PER2, PER3) and Cryptochrome (CRY1, Polymorphisms in this gene may be associated with behavioral changes in certain populations and with obesity and metabolic syndrome, The protein encoded by this gene plays a central role in the regulation of circadian rhythms, This protein encodes a transcription factor of the basic helix-loop-helix (bHLH) family and contains DNA binding histone acetyltransferase activity, CLOCK (Circadian Locomotor Output Cycles Kaput) is also known as KAT13D |
| Immunogen: |
Amino acids QKSIDFLRKHKEITAQSDASEIRQDWKPTFLSNEE of human CLOCK were used as the immunogen for the CLOCK antibody |
| Storage: |
Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the CLOCK antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term |
| Localization: |
cytoplasmic, Nuclear |
| Properties: |
C, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24° |
| Gene target: |
CLOCK |
| Short name: |
CLOCK Antibody |
| Technique: |
antibodies against human proteins, antibodies for, Antibody |
| Alternative name: |
CLOCK (Antibody to) |
| Alternative technique: |
antibodies |
| Identity: |
2082 |
| Gene: |
CLOCK |
More about : CLOCK |
| Long gene name: |
clock circadian regulator |
| Synonyms gene name: |
clock (mouse) homolog clock homolog (mouse) |
| Synonyms: |
KIAA0334 KAT13D bHLHe8 |
| Locus: |
4q12 |
| Discovery year: |
1999-04-19 |
| GenBank acession: |
AF011568 |
| Entrez gene record: |
9575 |
| Pubmed identfication: |
10198158 |
| RefSeq identity: |
NM_004898 |
| Classification: |
Basic helix-loop-helix proteins Lysine acetyltransferases |
| Havana BLAST/BLAT: |
OTTHUMG00000102141 |