| Category: |
Antibody |
| Concentration: |
2ml sterile DI water, 5mg/ml if reconstituted with 0 |
| Form: |
Antigen affinity purified |
| Conjugation: |
Unconjugated |
| Clone: |
Polyclonal antibody |
| Recognised antigen: |
HMGB3 / HMG4 |
| Host animal: |
Rabbit (Oryctolagus cuniculus) |
| Clonality: |
Polyclonal (rabbit origin) |
| Species reactivity: |
Due to limited knowledge and inability to test the antibody against all known species, Mouse (Mus musculus), Rat , we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens) |
| Tested applications: |
IHC-P, WB |
| Recommended dilutions: |
1-0, 5-1ug/ml, 5ug/ml, IHC (Paraffin): 0, Western blot: 0 |
| Notes: |
Optimal dilution of the HMG4 antibody should be determined by the researcher |
| Intented use: |
This HMG4 antibodyis to be used only for research purposes and not for diagnostics |
| Uniprot #: |
O15347 |
| Purity: |
Antigen affinity |
| Description: |
A mutation in this gene was associated with microphthalmia, Alternative splicing results in multiple transcript variants, The encoded protein plays an important role in maintaining stem cell populations, There are numerous pseudogenes of this gene on multiple chromosomes, This gene encodes a member of a family of proteins containing one or more high mobility group DNA-binding motifs, also known as HMG4, and may be aberrantly expressed in tumor cells, is a protein that in humans is encoded by the HMGB3 gene, syndromic 13, High-mobility group protein B |
| Immunogen: |
Amino acids EMAKADKVRYDREMKDYGPAKGGKKKKDPNAPKR of human HMG4 were used as the immunogen for the HMG4 antibody |
| Storage: |
Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the HMG4 antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term |
| Localization: |
Nuclear |
| Properties: |
C, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24° |
| Gene target: |
HMGB3 / HMG4 |
| Short name: |
HMGB3 Antibody / HMG4 |
| Technique: |
antibodies against human proteins, antibodies for, Antibody |
| Alternative name: |
HMGB3 (Antibody to) / HMG4 |
| Alternative technique: |
antibodies |
| Identity: |
5004 |
| Gene: |
HMGB3 |
More about : HMGB3 |
| Long gene name: |
high mobility group box 3 |
| Synonyms gene: |
HMG4 |
| Synonyms gene name: |
high-mobility group (nonhistone chromosomal) protein 4 high-mobility group box 3 |
| Synonyms: |
HMG2A MGC90319 |
| Synonyms name: |
non-histone chromosomal protein |
| Locus: |
Xq28 |
| Discovery year: |
1997-12-12 |
| GenBank acession: |
AF274572 |
| Entrez gene record: |
3149 |
| Pubmed identfication: |
9598312 |
| RefSeq identity: |
NM_005342 |
| Classification: |
Canonical high mobility group |
| Havana BLAST/BLAT: |
OTTHUMG00000024162 |