HMGB3 Antibody / HMG4

Contact us
Catalog number: R31810
Price: 1614 €
Supplier: MBS Recombinant Proteins
Product name: HMGB3 Antibody / HMG4
Quantity: 100ug
Related search:

More details :

Category: Antibody
Concentration: 2ml sterile DI water, 5mg/ml if reconstituted with 0
Form: Antigen affinity purified
Conjugation: Unconjugated
Clone: Polyclonal antibody
Recognised antigen: HMGB3 / HMG4
Host animal: Rabbit (Oryctolagus cuniculus)
Clonality: Polyclonal (rabbit origin)
Species reactivity: Due to limited knowledge and inability to test the antibody against all known species, Mouse (Mus musculus), Rat , we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens)
Tested applications: IHC-P, WB
Recommended dilutions: 1-0, 5-1ug/ml, 5ug/ml, IHC (Paraffin): 0, Western blot: 0
Notes: Optimal dilution of the HMG4 antibody should be determined by the researcher
Intented use: This HMG4 antibodyis to be used only for research purposes and not for diagnostics
Uniprot #: O15347
Purity: Antigen affinity
Description: A mutation in this gene was associated with microphthalmia, Alternative splicing results in multiple transcript variants, The encoded protein plays an important role in maintaining stem cell populations, There are numerous pseudogenes of this gene on multiple chromosomes, This gene encodes a member of a family of proteins containing one or more high mobility group DNA-binding motifs, also known as HMG4, and may be aberrantly expressed in tumor cells, is a protein that in humans is encoded by the HMGB3 gene, syndromic 13, High-mobility group protein B
Immunogen: Amino acids EMAKADKVRYDREMKDYGPAKGGKKKKDPNAPKR of human HMG4 were used as the immunogen for the HMG4 antibody
Storage: Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the HMG4 antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term
Localization: Nuclear
Properties: C, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24°
Gene target: HMGB3 / HMG4
Short name: HMGB3 Antibody / HMG4
Technique: antibodies against human proteins, antibodies for, Antibody
Alternative name: HMGB3 (Antibody to) / HMG4
Alternative technique: antibodies
Identity: 5004
Gene: HMGB3 | More about : HMGB3
Long gene name: high mobility group box 3
Synonyms gene: HMG4
Synonyms gene name: high-mobility group (nonhistone chromosomal) protein 4 high-mobility group box 3
Synonyms: HMG2A MGC90319
Synonyms name: non-histone chromosomal protein
Locus: Xq28
Discovery year: 1997-12-12
GenBank acession: AF274572
Entrez gene record: 3149
Pubmed identfication: 9598312
RefSeq identity: NM_005342
Classification: Canonical high mobility group
Havana BLAST/BLAT: OTTHUMG00000024162

Related Products :

MBS422091 Goat anti-HMGB3 / HMG4 Antibody 100ug 370 € MBS Polyclonals_1 human
R31810 HMGB3 Antibody / HMG4 0.1mg 406 € NJS poly human
MBS610453 HMG4 (High Mobility Group 4 (HMG) Transcription Factor, High Mobility Group Protein 2a, HMG2a, High Mobility Group Box 3, HMGB3, MGC90319, Nonhistone Chromosomal Protein HMG4) Antibody 100ul 785 € MBS Polyclonals_1 human
GENTAUR-58be31f4d8dea Anti- HMG4 Antibody 100ug 569 € MBS Polyclonals human
R34430-100UG HMG4 Antibody 0.1mg 406 € NJS poly human
AR51062PU-N anti-HMGB3 (1-180, His-tag) Antibody 0,5 mg 1109 € acr human
AR51062PU-S anti-HMGB3 (1-180, His-tag) Antibody 0,1 mg 485 € acr human
GENTAUR-58bde9c66179c Anti- HMGB3 Antibody 0.06 ml 265 € MBS Polyclonals human
GENTAUR-58bde9c721500 Anti- HMGB3 Antibody 0.12 ml 348 € MBS Polyclonals human
GENTAUR-58bdfc933a3af Anti- HMGB3 Antibody 0.12 ml 348 € MBS Polyclonals human
GENTAUR-58bdfc9395df6 Anti- HMGB3 Antibody 0.06 ml 265 € MBS Polyclonals human
GENTAUR-58be3cb25d217 Anti- HMGB3 Antibody 100ug 393 € MBS Polyclonals human
abx215953 Anti-HMGB3 Antibody 100 μg 311 € abbex human
AP52060PU-N anti-HMGB3 (Center) Antibody 0,4 ml 587 € acr human
MBS244014 Anti-Human HMGB3 Antibody 50ug 597 € MBS Polyclonals_1 human
F44053-0.08ML HMGB3 Antibody 0.08 ml 199 € NJS poly human
F44053-0.4ML HMGB3 Antibody 0.4 ml 406 € NJS poly human
GWB-462392 HMGB3 antibody 1 x 1 vial 411 € genways human
GWB-80267D HMGB3 antibody 1 volume 411 € genways human
MBS127237 HMGB3 Antibody 200ug 558 € MBS Polyclonals_1 human
abx919605 Anti-HMGB3 siRNA inquire 50 € abbex human
abx919606 Anti-HMGB3 siRNA 15 nmol 528 € abbex human
GWB-ATG366 HMGB3, 1-180aa, Human, His tag, E.coli bulk Ask price € genways bulk human
LV182128 HMGB3 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV) 1.0 µg DNA 322 € ABM lentivectors human
LV182129 HMGB3 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-C-term-HA) 1.0 µg DNA 322 € ABM lentivectors human
LV182130 HMGB3 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro) 1.0 µg DNA 322 € ABM lentivectors human
LV182131 HMGB3 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro) 1.0 µg DNA 322 € ABM lentivectors human
LV182133 HMGB3 Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a) 1.0 µg DNA 322 € ABM lentivectors human
LV182132 HMGB3 Lentiviral Vector (Human) (UbC) (pLenti-GIII-UbC) 1.0 µg DNA 322 € ABM lentivectors human
GENTAUR-58bc83872a8b1 Human High mobility group protein B3 (HMGB3) 100ug 1614 € MBS Recombinant Proteins human