| Category: |
Antibody |
| Concentration: |
2ml sterile DI water, 5mg/ml if reconstituted with 0 |
| Form: |
Antigen affinity purified |
| Conjugation: |
Unconjugated |
| Clone: |
Polyclonal antibody |
| Recognised antigen: |
OGT |
| Host animal: |
Rabbit (Oryctolagus cuniculus) |
| Clonality: |
Polyclonal (rabbit origin) |
| Species reactivity: |
Due to limited knowledge and inability to test the antibody against all known species, Mouse (Mus musculus), Rat , we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens) |
| Tested applications: |
IHC-P, WB |
| Recommended dilutions: |
1-0, 5-1ug/ml, 5ug/ml, IHC (Paraffin): 0, Western blot: 0 |
| Notes: |
Optimal dilution of the OGT antibody should be determined by the researcher |
| Intented use: |
This OGT antibodyis to be used only for research purposes and not for diagnostics |
| Uniprot #: |
O15294 |
| Purity: |
Antigen affinity |
| Description: |
Alternatively spliced transcript variants encoding distinct isoforms have been found for this gene, Since both phosphorylation and glycosylation compete for similar serine or threonine residues, The protein contains multiple tetratricopeptide repeats that are required for optimal recognition of substrates, This gene encodes a glycosyltransferase that catalyzes the addition of a single N-acetylglucosamine in O-glycosidic linkage to serine or threonine residues, or they may alter the substrate specificity of nearby sites by steric or electrostatic effects, the two processes may compete for sites, O-linked N-acetylglucosamine (O-GlcNAc) transferase (OGT) is an enzyme that in humans is encoded by the OGT gene |
| Immunogen: |
Amino acids NTKQYTMELERLYLQMWEHYAAGNKPDHMIKPVEVTESA of human OGT were used as the immunogen for the OGT antibody |
| Storage: |
Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the OGT antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term |
| Localization: |
cytoplasmic, Nuclear |
| Properties: |
C, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24° |
| Gene target: |
OGT |
| Short name: |
OGT Antibody |
| Technique: |
antibodies against human proteins, antibodies for, Antibody |
| Alternative name: |
OGT (Antibody to) |
| Alternative technique: |
antibodies |
| Identity: |
8127 |
| Gene: |
OGT |
More about : OGT |
| Long gene name: |
O-linked N-acetylglucosamine (GlcNAc) transferase |
| Synonyms gene name: |
O-linked N-acetylglucosamine (GlcNAc) transferase (UDP-N-acetylglucosamine:polypeptide-N-acetylglucosaminyl transferase) |
| Synonyms: |
O-GLCNAC HRNT1 MGC22921 FLJ23071 |
| Synonyms name: |
UDP-N-acetylglucosamine:polypeptide-N-acetylglucosaminyl transferase |
| Locus: |
Xq13, 1 |
| Discovery year: |
1998-12-03 |
| GenBank acession: |
U77413 |
| Entrez gene record: |
8473 |
| Pubmed identfication: |
9083068 |
| RefSeq identity: |
NM_003605 NM_181672 |
| Classification: |
O-linked N-acetylglucosaminyltransferases Tetratricopeptide repeat domain containing |
| Havana BLAST/BLAT: |
OTTHUMG00000033316 |
| Locus Specific Databases: |
Mental Retardation database |