OGT Antibody

Contact us
Catalog number: R31809
Price: 1553 €
Supplier: MBS Recombinant Proteins
Product name: OGT Antibody
Quantity: 100ug
Other quantities: 0.08 ml 199€ 0.1mg 406€ 0.4 ml 406€ 1 vial 521€
Related search:

More details :

Category: Antibody
Concentration: 2ml sterile DI water, 5mg/ml if reconstituted with 0
Form: Antigen affinity purified
Conjugation: Unconjugated
Clone: Polyclonal antibody
Recognised antigen: OGT
Host animal: Rabbit (Oryctolagus cuniculus)
Clonality: Polyclonal (rabbit origin)
Species reactivity: Due to limited knowledge and inability to test the antibody against all known species, Mouse (Mus musculus), Rat , we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens)
Tested applications: IHC-P, WB
Recommended dilutions: 1-0, 5-1ug/ml, 5ug/ml, IHC (Paraffin): 0, Western blot: 0
Notes: Optimal dilution of the OGT antibody should be determined by the researcher
Intented use: This OGT antibodyis to be used only for research purposes and not for diagnostics
Uniprot #: O15294
Purity: Antigen affinity
Description: Alternatively spliced transcript variants encoding distinct isoforms have been found for this gene, Since both phosphorylation and glycosylation compete for similar serine or threonine residues, The protein contains multiple tetratricopeptide repeats that are required for optimal recognition of substrates, This gene encodes a glycosyltransferase that catalyzes the addition of a single N-acetylglucosamine in O-glycosidic linkage to serine or threonine residues, or they may alter the substrate specificity of nearby sites by steric or electrostatic effects, the two processes may compete for sites, O-linked N-acetylglucosamine (O-GlcNAc) transferase (OGT) is an enzyme that in humans is encoded by the OGT gene
Immunogen: Amino acids NTKQYTMELERLYLQMWEHYAAGNKPDHMIKPVEVTESA of human OGT were used as the immunogen for the OGT antibody
Storage: Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the OGT antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term
Localization: cytoplasmic, Nuclear
Properties: C, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24°
Gene target: OGT
Short name: OGT Antibody
Technique: antibodies against human proteins, antibodies for, Antibody
Alternative name: OGT (Antibody to)
Alternative technique: antibodies
Identity: 8127
Gene: OGT | More about : OGT
Long gene name: O-linked N-acetylglucosamine (GlcNAc) transferase
Synonyms gene name: O-linked N-acetylglucosamine (GlcNAc) transferase (UDP-N-acetylglucosamine:polypeptide-N-acetylglucosaminyl transferase)
Synonyms: O-GLCNAC HRNT1 MGC22921 FLJ23071
Synonyms name: UDP-N-acetylglucosamine:polypeptide-N-acetylglucosaminyl transferase
Locus: Xq13, 1
Discovery year: 1998-12-03
GenBank acession: U77413
Entrez gene record: 8473
Pubmed identfication: 9083068
RefSeq identity: NM_003605 NM_181672
Classification: O-linked N-acetylglucosaminyltransferases Tetratricopeptide repeat domain containing
Havana BLAST/BLAT: OTTHUMG00000033316
Locus Specific Databases: Mental Retardation database

Related Products :

GWB-A94C5A O-linked GlcNAc Transferase (OGT) Goat antibody to or anti-Human Polyclonal (Internal) antibody 1 vial 602 € genways human
AP08866PU-N anti-OGT (543-555) Antibody 50 Вµg 732 € acr human
GENTAUR-58bdffffbc55e Anti- OGT Antibody 0.12 ml 348 € MBS Polyclonals human
GENTAUR-58be0000337d7 Anti- OGT Antibody 0.06 ml 265 € MBS Polyclonals human
GENTAUR-58be3c79035fb Anti- OGT Antibody 100ug 393 € MBS Polyclonals human
GENTAUR-58be457bb7df7 Anti- OGT Antibody 100ug 393 € MBS Polyclonals human
abx141655 Anti-OGT Antibody 200 μl 499 € abbex human
abx216038 Anti-OGT Antibody inquire 50 € abbex human
AP17608PU-N anti-OGT (C-term) Antibody 0,4 ml 587 € acr human
MBS420057 Goat anti-OGT Antibody 100ug 370 € MBS Polyclonals_1 human
MBS242102 Goat Polyclonal to Human OGT / O-GLCNAC Antibody 50ug 597 € MBS Polyclonals_1 human
F49797-0.08ML OGT Antibody 0.08 ml 199 € NJS poly human
F49797-0.4ML OGT Antibody 0.4 ml 406 € NJS poly human
GWB-MR424A OGT antibody 1 vial 521 € genways human
R31809 OGT Antibody 0.1mg 406 € NJS poly human
R36359-100UG OGT Antibody 0.1mg 406 € NJS poly human
MBS128573 OGT Polyclonal Antibody 50ug 304 € MBS Polyclonals_1 human
MBS170066 OGT Polyclonal Antibody 100ug 547 € MBS Polyclonals_1 human
abx903739 Anti-OGT siRNA 15 nmol 528 € abbex human
abx926814 Anti-OGT siRNA inquire 50 € abbex human
abx926815 Anti-OGT siRNA inquire 50 € abbex human
GENTAUR-58bc777a7b978 Archaeoglobus fulgidus Methylated-DNA--protein-cysteine methyltransferase (ogt) 100ug 1487 € MBS Recombinant Proteins human
GENTAUR-58bc777acf808 Archaeoglobus fulgidus Methylated-DNA--protein-cysteine methyltransferase (ogt) 1000ug 1487 € MBS Recombinant Proteins human
GENTAUR-58bc777b273be Archaeoglobus fulgidus Methylated-DNA--protein-cysteine methyltransferase (ogt) 100ug 1989 € MBS Recombinant Proteins human
GENTAUR-58bc777b5bfde Archaeoglobus fulgidus Methylated-DNA--protein-cysteine methyltransferase (ogt) 1000ug 1989 € MBS Recombinant Proteins human
GENTAUR-58bcca8be9fb9 Bacillus subtilis Methylated-DNA--protein-cysteine methyltransferase, constitutive (ogt) 100ug 1536 € MBS Recombinant Proteins human
GENTAUR-58bcca8c46a6d Bacillus subtilis Methylated-DNA--protein-cysteine methyltransferase, constitutive (ogt) 1000ug 1536 € MBS Recombinant Proteins human
GENTAUR-58bcca8ca173a Bacillus subtilis Methylated-DNA--protein-cysteine methyltransferase, constitutive (ogt) 100ug 2039 € MBS Recombinant Proteins human
GENTAUR-58bcca8cd990d Bacillus subtilis Methylated-DNA--protein-cysteine methyltransferase, constitutive (ogt) 1000ug 2039 € MBS Recombinant Proteins human
GENTAUR-58b8156c70a84 Escherichia coli Methylated-DNA--protein-cysteine methyltransferase (ogt) 100ug 1553 € MBS Recombinant Proteins human