MAPK13 Antibody / SAPK4

Contact us
Catalog number: R31807
Price: 332 €
Supplier: Bioss Primary Conjugated Antibodies.
Product name: MAPK13 Antibody / SAPK4
Quantity: 100ul
Related search:

More details :

Category: Antibody
Concentration: 2ml sterile DI water, 5mg/ml if reconstituted with 0
Form: Antigen affinity purified
Conjugation: Unconjugated
Clone: Polyclonal antibody
Recognised antigen: MAPK13 / SAPK4
Host animal: Rabbit (Oryctolagus cuniculus)
Clonality: Polyclonal (rabbit origin)
Species reactivity: Due to limited knowledge and inability to test the antibody against all known species, Mouse (Mus musculus), Rat , we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens)
Tested applications: IHC-P, WB
Recommended dilutions: 1-0, 5-1ug/ml, 5ug/ml, IHC (Paraffin): 0, Western blot: 0
Notes: Optimal dilution of the SAPK4 antibody should be determined by the researcher
Intented use: This SAPK4 antibodyis to be used only for research purposes and not for diagnostics
Uniprot #: O15264
Purity: Antigen affinity
Description: MAP kinase kinases 3, MAP kinases act as an integration point for multiple biochemical signals, The protein encoded by this gene is a member of the MAP kinase family, This kinase is closely related to p38 MAP kinase, Transcription factor ATF2, also called p38-DELTA or Stress-Activated Protein Kinase 4 (SAPK4), and 6 can phosphorylate and activate this kinase, and are involved in a wide variety of cellular processes such as proliferation, and microtubule dynamics regulator stathmin have been shown to be the substrates of this kinase, both of which can be activated by proinflammatory cytokines and cellular stress, differentiation, is an enzyme that in humans is encoded by the MAPK13 gene, transcription regulation and development, MAPK13 (Mitogen-Activated Protein Kinase 13)
Immunogen: Amino acids KLTVDEWKQHIYKEIVNFSPIARKDSRRRSGMKL of human MAPK13/SAPK4 were used as the immunogen for the SAPK4 antibody
Storage: Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the SAPK4 antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term
Localization: cytoplasmic, Nuclear
Properties: C, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24°
Gene target: MAPK13 / SAPK4
Short name: MAPK13 Antibody / SAPK4
Technique: antibodies against human proteins, antibodies for, Antibody
Alternative name: mitogen-activated protein phosphorylation catalyst 13 (Antibody to) / SAPK4
Alternative technique: antibodies
Alternative to gene target: Cytoplasm, DNA-templated and biological process this GO :0006355 and regulation of transcription, DNA-templated and biological process this GO :0006468 and protein phosphorylation and biological process this GO :0006950 and response to stress and biological process this GO :0006970 and response to osmotic stress and biological process this GO :0007049 and cell cycle and biological process this GO :0007265 and Ras protein signal transduction and biological process this GO :0016772 and transferase activity, MAPK 13 and MAPK-13 and p38delta and PRKM13 and SAPK4, MAPK13 and IDBG-630078 and ENSBTAG00000010007 and 535327, MAPK13 and IDBG-84731 and ENSG00000156711 and 5603, Mapk13 and IDBG-159128 and ENSMUSG00000004864 and 26415, this GO :0000165 and MAPK cascade and biological process this GO :0004672 and protein kinase activity and molecular function this GO :0004674 and protein serine/threonine kinase activity and molecular function this GO :0004707 and MAP kinase activity and molecular function this GO :0004713 and protein tyrosine kinase activity and molecular function this GO :0005515 and protein binding and molecular function this GO :0005524 and ATP binding and molecular function this GO :0005829 and cytosol and cellular component this GO :0006351 and transcription, this GO :0004672 : protein kinase activity, this GO :0004672 : protein kinase activity and also this GO :0004674 : protein serine/threonine kinase activity and also this GO :0004707 : MAP kinase activity and also this GO :0004713 : protein tyrosine kinase activity and also this GO :0005515 : protein binding and also this GO :0005524 : ATP binding and also this GO :0016772 : transferase activity, this GO :0004674 : protein serine/threonine kinase activity, this GO :0004707 : MAP kinase activity, this GO :0004713 : protein tyrosine kinase activity, this GO :0005515 : protein binding, this GO :0005524 : ATP binding, this GO :0016772 : transferase activity, transferase activity, transferring phosphorus-containing groups, transferring phosphorus-containing groups, transferring phosphorus-containing groups and molecular function this GO :0018105 and peptidyl-serine phosphorylation and biological process this GO :0032755 and positive regulation of interleukin-6 production and biological process this GO :0035556 and intracellular signal transduction and biological process this GO :0048011 and neurotrophin TRK receptor signaling pathway and biological process this GO :0050729 and positive regulation of inflammatory response and biological process, mitogen-activated protein kinase 13
Identity: 6875
Gene: MAPK13 | More about : MAPK13
Long gene name: mitogen-activated protein kinase 13
Synonyms gene: PRKM13
Synonyms: SAPK4 p38delta
Locus: 6p21, 31
Discovery year: 1998-04-28
GenBank acession: Y10488
Entrez gene record: 5603
Pubmed identfication: 9295308 9218798
Classification: Mitogen-activated protein kinases
Havana BLAST/BLAT: OTTHUMG00000014587

Related Products :

R31807 MAPK13 Antibody / SAPK4 0.1mg 406 € NJS poly human
MBS612289 SAPK4, p38 delta (Stress-activated Protein Kinase 4, Mitogen-activated Protein Kinase 13, MAP Kinase 13, MAPK 13, MAPK13, PRKM13, Mitogen-activated Protein Kinase p38 delta, MAP Kinase p38 delta, p38delta) Antibody 200ug 591 € MBS Polyclonals_1 human
MBS273203 SAPK4 antibody [N1C3] 100ul 426 € MBS Polyclonals_1 human
abx161217 Anti-SAPK4 Blocking Peptide inquire 50 € abbex human
AR50110PU-N anti-MAP kinase p38 delta / MAPK13 (1-365, His-tag) Antibody 0,5 mg 1109 € acr human
AR50110PU-S anti-MAP kinase p38 delta / MAPK13 (1-365, His-tag) Antibody 0,1 mg 485 € acr human
AM31024PU-N anti-MAP kinase p38 delta / MAPK13 Antibody 50 Вµg 819 € acr human
AM31025PU-N anti-MAP kinase p38 delta / MAPK13 Antibody 50 Вµg 819 € acr human
AM31044PU-N anti-MAP kinase p38 delta / MAPK13 Antibody 50 Вµg 819 € acr human
BB-PA1944 anti-MAP kinase p38 delta / MAPK13 Antibody 0,1 mg 471 € acr human
DB 1042 anti-MAP kinase p38 delta / MAPK13 Antibody 100 Tests 862 € acr human
DB 164-0.05 anti-MAP kinase p38 delta / MAPK13 (C-term) Antibody 50 Вµl 543 € acr human
DB 164-0.1 anti-MAP kinase p38 delta / MAPK13 (C-term) Antibody 0,1 ml 790 € acr human
AM00138PU-N anti-MAP kinase p38 delta / MAPK13 (N-term) (incl. pos. control) Antibody 0,1 mg 601 € acr human
GENTAUR-58bdee46ac313 Anti- MAPK13 Antibody 0.12 ml 348 € MBS Polyclonals human
GENTAUR-58bdee4723942 Anti- MAPK13 Antibody 0.06 ml 265 € MBS Polyclonals human
GENTAUR-58be10fb014ca Anti- MAPK13 Antibody 0.12 ml 348 € MBS Polyclonals human
GENTAUR-58be10fb5065f Anti- MAPK13 Antibody 0.06 ml 265 € MBS Polyclonals human
GENTAUR-58be4f8e8eb3a Anti- MAPK13 Antibody 100ug 387 € MBS Polyclonals human
GENTAUR-58be4f8f3329b Anti- MAPK13 Antibody 0.2 mg 558 € MBS Polyclonals human
GENTAUR-58be4f8f90c97 Anti- MAPK13 Antibody 50ug 304 € MBS Polyclonals human
MAPK13-101Y anti-MAPK13 Antibody 100 µg 357 € fabgen human
abx216677 Anti-MAPK13 Antibody 200 μg 369 € abbex human
MAPK13-Y-BIOTIN anti-MAPK13 Antibody BIOTIN 100 µg 456 € fabgen human
MAPK13-Y-FITC anti-MAPK13 Antibody FITC 100 µg 456 € fabgen human
GWB-MU325A MAPK13 antibody 1 vial 521 € genways human
GWB-MU326B MAPK13 antibody 1 vial 521 € genways human
R31045 MAPK13 Antibody 0.1mg 389 € NJS poly human
bs-7920R-A350 MAPK13 Antibody, ALEXA FLUOR 350 100ul 332 € Bioss Primary Conjugated Antibodies. human
bs-7920R-A488 MAPK13 Antibody, ALEXA FLUOR 488 100ul 332 € Bioss Primary Conjugated Antibodies. human