| Category: |
Antibody |
| Concentration: |
2ml sterile DI water, 5mg/ml if reconstituted with 0 |
| Form: |
Antigen affinity purified |
| Conjugation: |
Unconjugated |
| Clone: |
Polyclonal antibody |
| Recognised antigen: |
MAPK13 / SAPK4 |
| Host animal: |
Rabbit (Oryctolagus cuniculus) |
| Clonality: |
Polyclonal (rabbit origin) |
| Species reactivity: |
Due to limited knowledge and inability to test the antibody against all known species, Mouse (Mus musculus), Rat , we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens) |
| Tested applications: |
IHC-P, WB |
| Recommended dilutions: |
1-0, 5-1ug/ml, 5ug/ml, IHC (Paraffin): 0, Western blot: 0 |
| Notes: |
Optimal dilution of the SAPK4 antibody should be determined by the researcher |
| Intented use: |
This SAPK4 antibodyis to be used only for research purposes and not for diagnostics |
| Uniprot #: |
O15264 |
| Purity: |
Antigen affinity |
| Description: |
MAP kinase kinases 3, MAP kinases act as an integration point for multiple biochemical signals, The protein encoded by this gene is a member of the MAP kinase family, This kinase is closely related to p38 MAP kinase, Transcription factor ATF2, also called p38-DELTA or Stress-Activated Protein Kinase 4 (SAPK4), and 6 can phosphorylate and activate this kinase, and are involved in a wide variety of cellular processes such as proliferation, and microtubule dynamics regulator stathmin have been shown to be the substrates of this kinase, both of which can be activated by proinflammatory cytokines and cellular stress, differentiation, is an enzyme that in humans is encoded by the MAPK13 gene, transcription regulation and development, MAPK13 (Mitogen-Activated Protein Kinase 13) |
| Immunogen: |
Amino acids KLTVDEWKQHIYKEIVNFSPIARKDSRRRSGMKL of human MAPK13/SAPK4 were used as the immunogen for the SAPK4 antibody |
| Storage: |
Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the SAPK4 antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term |
| Localization: |
cytoplasmic, Nuclear |
| Properties: |
C, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24° |
| Gene target: |
MAPK13 / SAPK4 |
| Short name: |
MAPK13 Antibody / SAPK4 |
| Technique: |
antibodies against human proteins, antibodies for, Antibody |
| Alternative name: |
mitogen-activated protein phosphorylation catalyst 13 (Antibody to) / SAPK4 |
| Alternative technique: |
antibodies |
| Alternative to gene target: |
Cytoplasm, DNA-templated and biological process this GO :0006355 and regulation of transcription, DNA-templated and biological process this GO :0006468 and protein phosphorylation and biological process this GO :0006950 and response to stress and biological process this GO :0006970 and response to osmotic stress and biological process this GO :0007049 and cell cycle and biological process this GO :0007265 and Ras protein signal transduction and biological process this GO :0016772 and transferase activity, MAPK 13 and MAPK-13 and p38delta and PRKM13 and SAPK4, MAPK13 and IDBG-630078 and ENSBTAG00000010007 and 535327, MAPK13 and IDBG-84731 and ENSG00000156711 and 5603, Mapk13 and IDBG-159128 and ENSMUSG00000004864 and 26415, this GO :0000165 and MAPK cascade and biological process this GO :0004672 and protein kinase activity and molecular function this GO :0004674 and protein serine/threonine kinase activity and molecular function this GO :0004707 and MAP kinase activity and molecular function this GO :0004713 and protein tyrosine kinase activity and molecular function this GO :0005515 and protein binding and molecular function this GO :0005524 and ATP binding and molecular function this GO :0005829 and cytosol and cellular component this GO :0006351 and transcription, this GO :0004672 : protein kinase activity, this GO :0004672 : protein kinase activity and also this GO :0004674 : protein serine/threonine kinase activity and also this GO :0004707 : MAP kinase activity and also this GO :0004713 : protein tyrosine kinase activity and also this GO :0005515 : protein binding and also this GO :0005524 : ATP binding and also this GO :0016772 : transferase activity, this GO :0004674 : protein serine/threonine kinase activity, this GO :0004707 : MAP kinase activity, this GO :0004713 : protein tyrosine kinase activity, this GO :0005515 : protein binding, this GO :0005524 : ATP binding, this GO :0016772 : transferase activity, transferase activity, transferring phosphorus-containing groups, transferring phosphorus-containing groups, transferring phosphorus-containing groups and molecular function this GO :0018105 and peptidyl-serine phosphorylation and biological process this GO :0032755 and positive regulation of interleukin-6 production and biological process this GO :0035556 and intracellular signal transduction and biological process this GO :0048011 and neurotrophin TRK receptor signaling pathway and biological process this GO :0050729 and positive regulation of inflammatory response and biological process, mitogen-activated protein kinase 13 |
| Identity: |
6875 |
| Gene: |
MAPK13 |
More about : MAPK13 |
| Long gene name: |
mitogen-activated protein kinase 13 |
| Synonyms gene: |
PRKM13 |
| Synonyms: |
SAPK4 p38delta |
| Locus: |
6p21, 31 |
| Discovery year: |
1998-04-28 |
| GenBank acession: |
Y10488 |
| Entrez gene record: |
5603 |
| Pubmed identfication: |
9295308 9218798 |
| Classification: |
Mitogen-activated protein kinases |
| Havana BLAST/BLAT: |
OTTHUMG00000014587 |