Myosin Phosphatase Antibody / PPP1R12A

Contact us
Catalog number: R31804
Price: 717 €
Supplier: abbex
Product name: Myosin Phosphatase Antibody / PPP1R12A
Quantity: 30 nmol
Related search:

More details :

Category: Antibody
Concentration: 2ml sterile DI water, 5mg/ml if reconstituted with 0
Form: Antigen affinity purified
Conjugation: Unconjugated
Clone: Polyclonal antibody
Recognised antigen: Myosin Phosphatase / PPP1R12A
Host animal: Rabbit (Oryctolagus cuniculus)
Clonality: Polyclonal (rabbit origin)
Species reactivity: Due to limited knowledge and inability to test the antibody against all known species, Mouse (Mus musculus) , we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens)
Tested applications: IHC-P, WB
Recommended dilutions: 1-0, 5-1ug/ml, 5ug/ml, IHC (Paraffin): 0, Western blot: 0
Notes: Optimal dilution of the PPP1R12A antibody should be determined by the researcher
Intented use: This PPP1R12A antibodyis to be used only for research purposes and not for diagnostics
Uniprot #: O14974
Purity: Antigen affinity
Description: Jin et al, PPP1R12A is one of the subunits of myosin phosphatase, PPP1R12A is the protein that regulates PP1 function in smooth muscle relaxation, Ras activation, Sequencing analysis showed that human PPP1R12A contains 1, The PPP1R12A gene is mapped on 12q21, The cellular MYPT1-PP1-delta -specific inhibitor CPI17 caused a loss of merlin function characterized by merlin phosphorylation, also called MYPT1 (Myosin phosphatase target subunit 1), and transformation, by mutation of the NF2 gene and by upregulation of the oncoprotein CPI17, concluded that PPP1R12A and its substrate merlin are part of a previously undescribed tumor suppressor cascade that can be hindered in two ways, is an enzyme that in humans is encoded by the PPP1R12A gene, 030 amino acids with a calculated molecular mass of approximately 115 kD, 2-q21, 3, PPP1R12A (Protein phosphatase 1 regulatory subunit 12A)
Immunogen: Amino acids MKMADAKQKRNEQLKRWIGSETDLEPPVVKRQKTKVKFDD of human PPP1R12A were used as the immunogen for the PPP1R12A antibody
Storage: Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the PPP1R12A antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term
Localization: Cytoplasmic
Properties: C, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24°
Gene target: Myosin Phosphatase / PPP1R12A
Short name: Myosin Phosphatase Antibody / PPP1R12A
Technique: antibodies against human proteins, antibodies for, Antibody
Alternative name: Myosin Phosphatase (Antibody to) / PPP1R12A
Alternative technique: antibodies
Identity: 7618
Gene: PPP1R12A | More about : PPP1R12A
Long gene name: protein phosphatase 1 regulatory subunit 12A
Synonyms gene: MYPT1
Synonyms gene name: protein phosphatase 1, regulatory (inhibitor) subunit 12A protein phosphatase 1, regulatory subunit 12A
Synonyms: MBS M130
Synonyms name: myosin phosphatase-targeting subunit 1 myosin binding subunit
Locus: 12q21, 2-q21, 31
Discovery year: 1997-12-23
GenBank acession: D87930
Entrez gene record: 4659
Pubmed identfication: 9286714
RefSeq identity: NM_002480
Classification: Ankyrin repeat domain containing Protein phosphatase 1 regulatory subunits
Havana BLAST/BLAT: OTTHUMG00000170100

Related Products :

MBS612157 Myosin IIA, Non-muscle (Cellular Myosin Heavy Chain Type A, DFNA17, EPSTS, FTNS, MGC104539, MHA, MYH2A, MYH9, MYHas8, MyHC-2A, MyHC-IIa, MYHSA2, Myosin 9, Myosin Heavy Chain 9, Myosin Heavy Chain 9 Non-muscle, Myosin Heavy Chain Non-muscle IIa, Myosin Hea Antibody 200ul 702 € MBS Polyclonals_1 human
MBS610658 Myosin Skeletal Heavy and Light Chains (A1 Catalytic, A2 Catalytic, Alkali Myosin Light Chain 1, Extraocular Muscle Myosin Heavy Chain, Extraocular Myosin Heavy Chain, Fast Skeletal Myosin Alkali Light Chain 1, MLC1F, MLC3F, MYH13, MyHC-eo, MYL1, Myosin 1 Antibody 100ul 641 € MBS Polyclonals_1 human
R31804 Myosin Phosphatase Antibody / PPP1R12A 0.1mg 406 € NJS poly human
MBS619684 Myosin 9B (MYO9B, Myosin IXB, Celiac Disease 4, CELIAC4, MYR5, MYR-5, Unconventional Myosin 9b) Antibody 100ug 735 € MBS Polyclonals_1 human
AE26344CH Chicken Protein phosphatase 1 regulatory subunit 12A (PPP1R12A) ELISA Kit 48 wells plate 500 € ab-elisa elisas chicken
AE26344CH-96 Chicken Protein phosphatase 1 regulatory subunit 12A (PPP1R12A) ELISA Kit 1x plate of 96 wells 671 € abebio chicken
AE26344CH-48 ELISA test for Chicken Protein phosphatase 1 regulatory subunit 12A (PPP1R12A) 1x plate of 48 wells 402 € abebio chicken
MBS624619 Phosphatase, Alkaline, Placental (Alkaline phosphatase, placental type, Alkaline phosphatase Regan isozyme, ALP, FLJ61142, PALP, Placental alkaline phosphatase 1, PLAP, PLAP-1) Antibody 1 mililiter 835 € MBS Polyclonals_1 human
GWB-BBP556 Polyclonal antibody to or anti-PPP1R12A antibody 1 vial 463 € genways human
GENTAUR-58bdff11e7635 Anti- PPP1R12A Antibody 0.06 ml 265 € MBS Polyclonals human
GENTAUR-58bdff1268a6c Anti- PPP1R12A Antibody 0.12 ml 348 € MBS Polyclonals human
GENTAUR-58be1481d4778 Anti- PPP1R12A Antibody 0.06 ml 265 € MBS Polyclonals human
GENTAUR-58be14824b8af Anti- PPP1R12A Antibody 0.12 ml 348 € MBS Polyclonals human
GENTAUR-58be589116aa3 Anti- PPP1R12A Antibody 100ug 387 € MBS Polyclonals human
GENTAUR-58be58915d195 Anti- PPP1R12A Antibody 0.2 mg 558 € MBS Polyclonals human
GENTAUR-58be5891b2116 Anti- PPP1R12A Antibody 50ug 304 € MBS Polyclonals human
AP06543PU-N anti-PPP1R12A / MYPT1 Antibody 0,1 mg 558 € acr human
AP06544PU-N anti-PPP1R12A / MYPT1 Antibody 0,1 mg 558 € acr human
AP22981PU-N anti-PPP1R12A / MYPT1 Antibody 50 Вµg 732 € acr human
B0517-1 anti-PPP1R12A / MYPT1 Antibody 50 Вµg 347 € acr human
B0517-2 anti-PPP1R12A / MYPT1 Antibody 0,1 mg 500 € acr human
B0518-1 anti-PPP1R12A / MYPT1 Antibody 50 Вµg 347 € acr human
B0518-2 anti-PPP1R12A / MYPT1 Antibody 0,1 mg 500 € acr human
BB-PA1681 anti-PPP1R12A / MYPT1 Antibody 0,1 mg 471 € acr human
AP55226SU-N anti-PPP1R12A / MYPT1 pThr1 Antibody 0,2 ml 630 € acr human
MBS244384 Goat Polyclonal to Human PPP1R12A / MYPT1 Antibody 50ug 597 € MBS Polyclonals_1 human
GWB-MW177F PPP1R12A antibody 1 vial 521 € genways human
abx904176 Anti-PPP1R12A siRNA 30 nmol 717 € abbex human
abx929463 Anti-PPP1R12A siRNA 30 nmol 717 € abbex human
abx929464 Anti-PPP1R12A siRNA 30 nmol 717 € abbex human