MEIS1 Antibody

Contact us
Catalog number: R31789
Price: 406 €
Supplier: NJS poly
Product name: MEIS1 Antibody
Quantity: 0.1mg
Other quantities: 0.1mg 406€ 1 vial 521€
Related search:

More details :

Category: Antibody
Concentration: 2ml sterile DI water, 5mg/ml if reconstituted with 0
Form: Antigen affinity purified
Conjugation: Unconjugated
Clone: Polyclonal antibody
Recognised antigen: MEIS1
Host animal: Rabbit (Oryctolagus cuniculus)
Clonality: Polyclonal (rabbit origin)
Species reactivity: Due to limited knowledge and inability to test the antibody against all known species, Mouse (Mus musculus), Rat , we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens)
Tested applications: WB
Recommended dilutions: 1-0, 5ug/ml, Western blot: 0
Notes: Optimal dilution of the MEIS1 antibody should be determined by the researcher
Intented use: This MEIS1 antibodyis to be used only for research purposes and not for diagnostics
Uniprot #: O00470
Purity: Antigen affinity
Description: HOXA10, Homeobox genes, In addition, MEIS1 encodes a novel homeobox protein belonging to the TALE (three amino acid loop extension) family of homeodomain-containing proteins, The Meis1 locus is isolated as a common site of viral integration involved in myeloid leukemia in BXH-2 mice, The homeodomain of MEIS1 is the only conserved motif within the entire 390-amino acid protein, This gene is mapped to chromosome 2p14-p13, and HOXB8 play important roles in leukemia, of which the most well-characterized category is represented by the HOX genes, play a crucial role in normal development, several homeoproteins are involved in neoplasia: PPX1, Homeobox protein Meis1 is a protein that in humans is encoded by the MEIS1 gene
Immunogen: Amino acids DPHAARSMQPVHHLNHGPPLHSHQYPHTAHTNAMA of human MEIS1 were used as the immunogen for the MEIS1 antibody
Storage: Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the MEIS1 antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term
Properties: C, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24°
Gene target: MEIS1
Short name: MEIS1 Antibody
Technique: antibodies against human proteins, antibodies for, Antibody
Alternative name: MEIS1 (Antibody to)
Alternative technique: antibodies
Identity: 7000
Gene: MEIS1 | More about : MEIS1
Long gene name: Meis homeobox 1
Synonyms gene name: Meis1 (mouse) homolog Meis1, myeloid ecotropic viral integration site 1 homolog (mouse)
Locus: 2p14
Discovery year: 1996-12-17
Entrez gene record: 4211
Pubmed identfication: 7565694
RefSeq identity: NM_002398
Classification: TALE class homeoboxes and pseudogenes
Havana BLAST/BLAT: OTTHUMG00000150714

Related Products :