| Category: |
Antibody |
| Concentration: |
2ml sterile DI water, 5mg/ml if reconstituted with 0 |
| Form: |
Antigen affinity purified |
| Conjugation: |
Unconjugated |
| Clone: |
Polyclonal antibody |
| Recognised antigen: |
MEIS1 |
| Host animal: |
Rabbit (Oryctolagus cuniculus) |
| Clonality: |
Polyclonal (rabbit origin) |
| Species reactivity: |
Due to limited knowledge and inability to test the antibody against all known species, Mouse (Mus musculus), Rat , we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens) |
| Tested applications: |
WB |
| Recommended dilutions: |
1-0, 5ug/ml, Western blot: 0 |
| Notes: |
Optimal dilution of the MEIS1 antibody should be determined by the researcher |
| Intented use: |
This MEIS1 antibodyis to be used only for research purposes and not for diagnostics |
| Uniprot #: |
O00470 |
| Purity: |
Antigen affinity |
| Description: |
HOXA10, Homeobox genes, In addition, MEIS1 encodes a novel homeobox protein belonging to the TALE (three amino acid loop extension) family of homeodomain-containing proteins, The Meis1 locus is isolated as a common site of viral integration involved in myeloid leukemia in BXH-2 mice, The homeodomain of MEIS1 is the only conserved motif within the entire 390-amino acid protein, This gene is mapped to chromosome 2p14-p13, and HOXB8 play important roles in leukemia, of which the most well-characterized category is represented by the HOX genes, play a crucial role in normal development, several homeoproteins are involved in neoplasia: PPX1, Homeobox protein Meis1 is a protein that in humans is encoded by the MEIS1 gene |
| Immunogen: |
Amino acids DPHAARSMQPVHHLNHGPPLHSHQYPHTAHTNAMA of human MEIS1 were used as the immunogen for the MEIS1 antibody |
| Storage: |
Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the MEIS1 antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term |
| Properties: |
C, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24° |
| Gene target: |
MEIS1 |
| Short name: |
MEIS1 Antibody |
| Technique: |
antibodies against human proteins, antibodies for, Antibody |
| Alternative name: |
MEIS1 (Antibody to) |
| Alternative technique: |
antibodies |
| Identity: |
7000 |
| Gene: |
MEIS1 |
More about : MEIS1 |
| Long gene name: |
Meis homeobox 1 |
| Synonyms gene name: |
Meis1 (mouse) homolog Meis1, myeloid ecotropic viral integration site 1 homolog (mouse) |
| Locus: |
2p14 |
| Discovery year: |
1996-12-17 |
| Entrez gene record: |
4211 |
| Pubmed identfication: |
7565694 |
| RefSeq identity: |
NM_002398 |
| Classification: |
TALE class homeoboxes and pseudogenes |
| Havana BLAST/BLAT: |
OTTHUMG00000150714 |