MEIS1 Antibody

Contact us
Catalog number: R31789
Price: 414 €
Supplier: genways
Product name: MEIS1 Antibody
Quantity: 1 vial
Other quantities: 0.1mg 406€ 1 vial 521€
Related search:

More details :

Category: Antibody
Concentration: 2ml sterile DI water, 5mg/ml if reconstituted with 0
Form: Antigen affinity purified
Conjugation: Unconjugated
Clone: Polyclonal antibody
Recognised antigen: MEIS1
Host animal: Rabbit (Oryctolagus cuniculus)
Clonality: Polyclonal (rabbit origin)
Species reactivity: Due to limited knowledge and inability to test the antibody against all known species, Mouse (Mus musculus), Rat , we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens)
Tested applications: WB
Recommended dilutions: 1-0, 5ug/ml, Western blot: 0
Notes: Optimal dilution of the MEIS1 antibody should be determined by the researcher
Intented use: This MEIS1 antibodyis to be used only for research purposes and not for diagnostics
Uniprot #: O00470
Purity: Antigen affinity
Description: HOXA10, Homeobox genes, In addition, MEIS1 encodes a novel homeobox protein belonging to the TALE (three amino acid loop extension) family of homeodomain-containing proteins, The Meis1 locus is isolated as a common site of viral integration involved in myeloid leukemia in BXH-2 mice, The homeodomain of MEIS1 is the only conserved motif within the entire 390-amino acid protein, This gene is mapped to chromosome 2p14-p13, and HOXB8 play important roles in leukemia, of which the most well-characterized category is represented by the HOX genes, play a crucial role in normal development, several homeoproteins are involved in neoplasia: PPX1, Homeobox protein Meis1 is a protein that in humans is encoded by the MEIS1 gene
Immunogen: Amino acids DPHAARSMQPVHHLNHGPPLHSHQYPHTAHTNAMA of human MEIS1 were used as the immunogen for the MEIS1 antibody
Storage: Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the MEIS1 antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term
Properties: C, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24°
Gene target: MEIS1
Short name: MEIS1 Antibody
Technique: antibodies against human proteins, antibodies for, Antibody
Alternative name: MEIS1 (Antibody to)
Alternative technique: antibodies
Identity: 7000
Gene: MEIS1 | More about : MEIS1
Long gene name: Meis homeobox 1
Synonyms gene name: Meis1 (mouse) homolog Meis1, myeloid ecotropic viral integration site 1 homolog (mouse)
Locus: 2p14
Discovery year: 1996-12-17
Entrez gene record: 4211
Pubmed identfication: 7565694
RefSeq identity: NM_002398
Classification: TALE class homeoboxes and pseudogenes
Havana BLAST/BLAT: OTTHUMG00000150714

Related Products :

GENTAUR-58bcae8e079fd Human Homeobox protein Meis1 (MEIS1) 100ug 2100 € MBS Recombinant Proteins human
GENTAUR-58bcae8e57296 Human Homeobox protein Meis1 (MEIS1) 1000ug 2100 € MBS Recombinant Proteins human
GENTAUR-58bcae8e9e7cd Human Homeobox protein Meis1 (MEIS1) 100ug 2614 € MBS Recombinant Proteins human
GENTAUR-58bcae8ed4ceb Human Homeobox protein Meis1 (MEIS1) 1000ug 2614 € MBS Recombinant Proteins human
GENTAUR-58ba1e0666bf4 Xenopus laevis Homeobox protein Meis1 (meis1) 100ug 2100 € MBS Recombinant Proteins xenopus
GENTAUR-58ba1e0711ea1 Xenopus laevis Homeobox protein Meis1 (meis1) 1000ug 2100 € MBS Recombinant Proteins xenopus
GENTAUR-58ba1e074d903 Xenopus laevis Homeobox protein Meis1 (meis1) 100ug 2614 € MBS Recombinant Proteins xenopus
GENTAUR-58ba1e07d5061 Xenopus laevis Homeobox protein Meis1 (meis1) 1000ug 2614 € MBS Recombinant Proteins xenopus
AP20611PU-N anti-MEIS1 Antibody 0,1 mg 558 € acr human
GENTAUR-58bdea1f6ddcc Anti- MEIS1 Antibody 0.12 ml 348 € MBS Polyclonals human
GENTAUR-58bdea1fb0967 Anti- MEIS1 Antibody 0.06 ml 265 € MBS Polyclonals human
GENTAUR-58be122734f7f Anti- MEIS1 Antibody 0.12 ml 348 € MBS Polyclonals human
GENTAUR-58be1227a6855 Anti- MEIS1 Antibody 0.06 ml 265 € MBS Polyclonals human
abx216792 Anti-MEIS1 Antibody 200 μg 369 € abbex human
abx133236 Anti-MEIS1 Antibody (KLH) 200 ul 398 € abbex human
MBS422039 Goat anti-MEIS1 Antibody 100ug 370 € MBS Polyclonals_1 human
GWB-ML236B MEIS1 antibody 1 vial 521 € genways human
GWB-MM686B Meis1 antibody 1 vial 521 € genways human
GWB-MM687C MEIS1 antibody 1 vial 521 € genways human
R31789 MEIS1 Antibody 0.1mg 406 € NJS poly human
R35866-100UG MEIS1 Antibody 0.1mg 406 € NJS poly human
MBS248283 PAb (IgG) to Human MEIS1 Antibody 50ug 597 € MBS Polyclonals_1 human
abx161945 Anti-MEIS1 Blocking Peptide inquire 50 € abbex human
abx923914 Anti-MEIS1 siRNA 30 nmol 717 € abbex human
abx923915 Anti-MEIS1 siRNA 15 nmol 528 € abbex human
LV217617 MEIS1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV) 1.0 µg DNA 600 € ABM lentivectors human
GWB-F59924 MEIS1 Over-expression Lysate reagent 1 vial 463 € genways human
MBS244072 PAb (IgG) to Human MEIS1 50ug 597 € MBS Polyclonals_1 human
GWB-4E3CF6 antibody to or anti- CXC Chemokine Receptor 4 (CXCR4) Rabbit antibody to or anti-Human Polyclonal antibody antibody 1 x 1 vial 602 € genways human
GWB-BFD0EE antibody to or anti- Affinity Purified Chicken antibody to or anti-Pig CRP antibody 1 vial 414 € genways pig