| Category: |
Antibody |
| Concentration: |
2ml sterile DI water, 5mg/ml if reconstituted with 0 |
| Form: |
Antigen affinity purified |
| Conjugation: |
Unconjugated |
| Clone: |
Polyclonal antibody |
| Recognised antigen: |
PGRMC1 |
| Host animal: |
Rabbit (Oryctolagus cuniculus) |
| Clonality: |
Polyclonal (rabbit origin) |
| Species reactivity: |
Due to limited knowledge and inability to test the antibody against all known species, Mouse (Mus musculus), Rat , we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens) |
| Tested applications: |
IHC-P, WB |
| Recommended dilutions: |
1-0, 5-1ug/ml, 5ug/ml, IHC (Paraffin): 0, Western blot: 0 |
| Notes: |
Optimal dilution of the PGRMC1 antibody should be determined by the researcher |
| Intented use: |
This PGRMC1 antibodyis to be used only for research purposes and not for diagnostics |
| Uniprot #: |
O00264 |
| Purity: |
Antigen affinity |
| Description: |
Also, However, In humans, It binds and activates P450 proteins, PGRMC1 binds to PAIR-BP1 (plasminogen activator inhibitor RNA-binding protein-1), PGRMC1 shares key structural motifs with cytochrome b5, The Sigma-2 receptor was recently identified as potentially being the same as PGRMC1, The sole biochemical function of PGRMC1 is heme-binding, These may include binding to Insig (insulin-induced gene), hormone and lipid metabolism, its expression outside of the reproductive tract and in males suggests multiple functions for the protein, the protein is encoded by the PGRMC1 gene, which are important in drug, which regulates cholesterol synthesis, Progesterone receptor membrane component 1 is a protein which co-purifies with progesterone binding proteins in the liver and ovary |
| Immunogen: |
Amino acids RLKRRDFTPAELRRFDGVQDPRILMAINGKVFDVTK of the human protein were used as the immunogen for the PGRMC1 antibody |
| Storage: |
Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the PGRMC1 antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term |
| Localization: |
Cytoplasmic |
| Properties: |
C, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24° |
| Gene target: |
PGRMC1 |
| Short name: |
PGRMC1 Antibody |
| Technique: |
antibodies against human proteins, antibodies for, Antibody |
| Alternative name: |
PGRMC1 (Antibody to) |
| Alternative technique: |
antibodies |
| Identity: |
16090 |
| Gene: |
PGRMC1 |
More about : PGRMC1 |
| Long gene name: |
progesterone receptor membrane component 1 |
| Synonyms: |
HPR6, 6 |
| Locus: |
Xq24 |
| Discovery year: |
2001-07-25 |
| Entrez gene record: |
10857 |
| Pubmed identfication: |
9705155 |
| RefSeq identity: |
NM_006667 |
| Classification: |
Membrane associated progesterone receptor family |
| Havana BLAST/BLAT: |
OTTHUMG00000022268 |
| Locus Specific Databases: |
Mental Retardation database |