PGRMC1 Antibody

Contact us
Catalog number: R31787
Price: 667 €
Supplier: genways
Product name: PGRMC1 Antibody
Quantity: 1 tube
Other quantities: 0.1mg 406€ 1 vial 521€
Related search:

More details :

Category: Antibody
Concentration: 2ml sterile DI water, 5mg/ml if reconstituted with 0
Form: Antigen affinity purified
Conjugation: Unconjugated
Clone: Polyclonal antibody
Recognised antigen: PGRMC1
Host animal: Rabbit (Oryctolagus cuniculus)
Clonality: Polyclonal (rabbit origin)
Species reactivity: Due to limited knowledge and inability to test the antibody against all known species, Mouse (Mus musculus), Rat , we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens)
Tested applications: IHC-P, WB
Recommended dilutions: 1-0, 5-1ug/ml, 5ug/ml, IHC (Paraffin): 0, Western blot: 0
Notes: Optimal dilution of the PGRMC1 antibody should be determined by the researcher
Intented use: This PGRMC1 antibodyis to be used only for research purposes and not for diagnostics
Uniprot #: O00264
Purity: Antigen affinity
Description: Also, However, In humans, It binds and activates P450 proteins, PGRMC1 binds to PAIR-BP1 (plasminogen activator inhibitor RNA-binding protein-1), PGRMC1 shares key structural motifs with cytochrome b5, The Sigma-2 receptor was recently identified as potentially being the same as PGRMC1, The sole biochemical function of PGRMC1 is heme-binding, These may include binding to Insig (insulin-induced gene), hormone and lipid metabolism, its expression outside of the reproductive tract and in males suggests multiple functions for the protein, the protein is encoded by the PGRMC1 gene, which are important in drug, which regulates cholesterol synthesis, Progesterone receptor membrane component 1 is a protein which co-purifies with progesterone binding proteins in the liver and ovary
Immunogen: Amino acids RLKRRDFTPAELRRFDGVQDPRILMAINGKVFDVTK of the human protein were used as the immunogen for the PGRMC1 antibody
Storage: Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the PGRMC1 antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term
Localization: Cytoplasmic
Properties: C, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24°
Gene target: PGRMC1
Short name: PGRMC1 Antibody
Technique: antibodies against human proteins, antibodies for, Antibody
Alternative name: PGRMC1 (Antibody to)
Alternative technique: antibodies
Identity: 16090
Gene: PGRMC1 | More about : PGRMC1
Long gene name: progesterone receptor membrane component 1
Synonyms: HPR6, 6
Locus: Xq24
Discovery year: 2001-07-25
Entrez gene record: 10857
Pubmed identfication: 9705155
RefSeq identity: NM_006667
Classification: Membrane associated progesterone receptor family
Havana BLAST/BLAT: OTTHUMG00000022268
Locus Specific Databases: Mental Retardation database

Related Products :

GENTAUR-58be0ce716a4f Anti- PGRMC1 Antibody 0.06 ml 265 € MBS Polyclonals human
GENTAUR-58be0ce76f0b0 Anti- PGRMC1 Antibody 0.12 ml 348 € MBS Polyclonals human
GENTAUR-58be426c6f329 Anti- PGRMC1 Antibody 100ug 393 € MBS Polyclonals human
GENTAUR-58be524ce334e Anti- PGRMC1 Antibody 0.2 mg 558 € MBS Polyclonals human
GENTAUR-58be524d6406a Anti- PGRMC1 Antibody 50ug 304 € MBS Polyclonals human
GENTAUR-58be524dd9582 Anti- PGRMC1 Antibody 100ug 387 € MBS Polyclonals human
abx216921 Anti-PGRMC1 Antibody 200 μg 369 € abbex human
MBS420498 Goat anti-PGRMC1 / MPR Antibody 100ug 370 € MBS Polyclonals_1 human
MBS248603 Goat Polyclonal to Human PGRMC1 / MPR Antibody 50ug 597 € MBS Polyclonals_1 human
GWB-MQ550A PGRMC1 antibody 1 vial 521 € genways human
R31787 PGRMC1 Antibody 0.1mg 406 € NJS poly human
R33917-100UG PGRMC1 Antibody 0.1mg 406 € NJS poly human
MBS170136 PGRMC1 Polyclonal Antibody 100ug 547 € MBS Polyclonals_1 human
MBS611059 Progesterone Receptor Membrane Component 1 (PGRMC1, PGRMC, HGNC:16090, HPR6.6, Membrane-associated Progesterone Receptor Component 1, mPR) Antibody 100ug 735 € MBS Polyclonals_1 human
abx903977 Anti-PGRMC1 siRNA inquire 50 € abbex human
abx928394 Anti-PGRMC1 siRNA 15 nmol 528 € abbex human
abx928395 Anti-PGRMC1 siRNA 30 nmol 717 € abbex human
GENTAUR-58bcb0619d717 Human Membrane-associated progesterone receptor component 1 (PGRMC1) 100ug 1503 € MBS Recombinant Proteins human
GENTAUR-58bcb061e964a Human Membrane-associated progesterone receptor component 1 (PGRMC1) 1000ug 1503 € MBS Recombinant Proteins human
GENTAUR-58bcb0623d751 Human Membrane-associated progesterone receptor component 1 (PGRMC1) 100ug 2006 € MBS Recombinant Proteins human
GENTAUR-58bcb062761d3 Human Membrane-associated progesterone receptor component 1 (PGRMC1) 1000ug 2006 € MBS Recombinant Proteins human
GENTAUR-58bc12a43b982 Mouse Membrane-associated progesterone receptor component 1 (Pgrmc1) 100ug 1503 € MBS Recombinant Proteins mouse
GENTAUR-58bc12a4890fe Mouse Membrane-associated progesterone receptor component 1 (Pgrmc1) 1000ug 1503 € MBS Recombinant Proteins mouse
GENTAUR-58bc12a4d660f Mouse Membrane-associated progesterone receptor component 1 (Pgrmc1) 100ug 2006 € MBS Recombinant Proteins mouse
GENTAUR-58bc12a539d2a Mouse Membrane-associated progesterone receptor component 1 (Pgrmc1) 1000ug 2006 € MBS Recombinant Proteins mouse
LV261109 PGRMC1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV) 1.0 µg DNA 322 € ABM lentivectors human
GWB-9DFA20 PGRMC1 Over-expression Lysate reagent 1 vial 463 € genways human
GWB-4E3CF6 antibody to or anti- CXC Chemokine Receptor 4 (CXCR4) Rabbit antibody to or anti-Human Polyclonal antibody antibody 1 x 1 vial 602 € genways human
GWB-BFD0EE antibody to or anti- Affinity Purified Chicken antibody to or anti-Pig CRP antibody 1 vial 414 € genways pig
GWB-75D1D0 antibody to or anti-ALPHA-1-antibody to or anti-TRYPSIN antibody 1 tube 667 € genways human