CDK5R1 Antibody

Contact us
Catalog number: R30162
Price: 602 €
Supplier: genways
Product name: CDK5R1 Antibody
Quantity: 1 x 1 vial
Other quantities: 1 vial 532€
Related search:

More details :

Category: Antibody
Concentration: 2ml sterile DI water, 5mg/ml if reconstituted with 0
Form: Antigen affinity purified
Conjugation: Unconjugated
Clone: Polyclonal antibody
Recognised antigen: CDK5R1
Host animal: Rabbit (Oryctolagus cuniculus)
Clonality: Polyclonal (rabbit origin)
Species reactivity: Due to limited knowledge and inability to test the antibody against all known species, we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens)
Tested applications: WB
Recommended dilutions: 5-1ug/ml, Western blot: 0
Notes: Titration of the CDK5R1 antibody may be required due to differences in protocols and secondary/substrate sensitivity, The stated application concentrations are suggested starting amounts
Intented use: This CDK5R1 antibodyis to be used only for research purposes and not for diagnostics
Gene ID #: 8851
Purity: Antigen affinity
Description: CDK5R or NCK5A, P25 deregulates CDK5 activity by prolonging its activation and changing its cellular location, The cleavage of p35 into p25 results in relocalization of the protein from the cell periphery to nuclear and perinuclear regions, The p25 form accumulates in the brain neurons of patients with Alzheimers disease, The p35 form of this protein is proteolytically cleaved by calpain, The protein encoded by this gene (p35) is a neuron-specific activator of cyclin-dependent kinase 5 (CDK5), This accumulation correlates with an increase in CDK5 kinase activity, and may lead to aberrantly phosphorylated forms of the microtubule-associated protein tau, generating a p25 form, the activation of CDK5 is required for proper development of the central nervous system, which contributes to Alzheimers disease, CDK5R1 is also known as p35
Immunogen: An amino acid sequence from the N-terminus of human CDK5R1 (YRKATLFEDGAATVGHYTAVQNSKNAKDKNLKRH) was used as the immunogen for this CDK5R1 antibody
Storage: Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, For long-term, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the CDK5R1 antibody can be stored for up to one month at 4oC, After reconstitution
Properties: C, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24°
Gene target: CDK5R1
Short name: CDK5R1 Antibody
Technique: antibodies against human proteins, antibodies for, Antibody
Alternative name: regulatory subunit 1 (p35) (Antibody to), cyclin-dependent kinase 5
Alternative technique: antibodies
Alternative to gene target: CDK5P35 and CDK5R and NCK5A and p23 and p25 and p35 and p35nck5a, CDK5R1 and IDBG-40195 and ENSG00000176749 and 8851, CDK5R1 and IDBG-647094 and ENSBTAG00000004475 and 282173, Cdk5r1 and IDBG-204311 and ENSMUSG00000048895 and 12569, DNA-templated and biological process this GO :0046875 and ephrin receptor binding and molecular function this GO :0048013 and ephrin receptor signaling pathway and biological process this GO :0048471 and perinuclear region of cytoplasm and cellular component this GO :0048511 and rhythmic process and biological process this GO :0051726 and regulation of cell cycle and biological process this GO :0061001 and regulation of dendritic spine morphogenesis and biological process this GO :0070507 and regulation of microtubule cytoskeleton organization and biological process this GO :0090314 and positive regulation of protein targeting to membrane and biological process, ephrin receptor binding, nuclei, regulatory subunit 1 (p35), this GO :0000079 and regulation of cyclin-dependent protein serine/threonine kinase activity and biological process this GO :0001764 and neuron migration and biological process this GO :0004672 and protein kinase activity and molecular function this GO :0004693 and cyclin-dependent protein serine/threonine kinase activity and molecular function this GO :0005509 and calcium ion binding and molecular function this GO :0005515 and protein binding and molecular function this GO :0005634 and nucleus and cellular component this GO :0005737 and cytoplasm and cellular component this GO :0005829 and cytosol and cellular component this GO :0005886 and plasma membrane and cellular component this GO :0006468 and protein phosphorylation and biological process this GO :0007158 and neuron cell-cell adhesion and biological process this GO :0007213 and G-protein coupled acetylcholine receptor signaling pathway and biological process this GO :0007411 and axon guidance and biological process this GO :0007413 and axonal fasciculation and biological process this GO :0007420 and brain development and biological process this GO :0008283 and cell proliferation and biological process this GO :0009790 and embryo development and biological process this GO :0014069 and postsynaptic density and cellular component this GO :0016020 and membrane and cellular component this GO :0016301 and kinase activity and molecular function this GO :0016533 and cyclin-dependent protein kinase 5 holoenzyme complex and cellular component this GO :0016534 and cyclin-dependent protein kinase 5 activator activity and molecular function this GO :0018105 and peptidyl-serine phosphorylation and biological process this GO :0018107 and peptidyl-threonine phosphorylation and biological process this GO :0019901 and protein kinase binding and molecular function this GO :0021549 and cerebellum development and biological process this GO :0021722 and superior olivary nucleus maturation and biological process this GO :0021766 and hippocampus development and biological process this GO :0021799 and cerebral cortex radially oriented cell migration and biological process this GO :0021819 and layer formation in cerebral cortex and biological process this GO :0030182 and neuron differentiation and biological process this GO :0030424 and axon and cellular component this GO :0030425 and dendrite and cellular component this GO :0030426 and growth cone and cellular component this GO :0030517 and negative regulation of axon extension and biological process this GO :0031175 and neuron projection development and biological process this GO :0031594 and neuromuscular junction and cellular component this GO :0032956 and regulation of actin cytoskeleton organization and biological process this GO :0033136 and serine phosphorylation of STAT3 protein and biological process this GO :0035235 and ionotropic glutamate receptor signaling pathway and biological process this GO :0043025 and neuronal cell body and cellular component this GO :0043197 and dendritic spine and cellular component this GO :0043292 and contractile fiber and cellular component this GO :0043525 and positive regulation of neuron apoptotic process and biological process this GO :0043539 and protein serine/threonine kinase activator activity and molecular function this GO :0045296 and cadherin binding and molecular function this GO :0045664 and regulation of neuron differentiation and biological process this GO :0045860 and positive regulation of protein kinase activity and biological process this GO :0045892 and negative regulation of transcription, this GO :0004672 : protein kinase activity, this GO :0004672 : protein kinase activity and also this GO :0004693 : cyclin-dependent protein serine/threonine kinase activity and also this GO :0005509 : calcium ion binding and also this GO :0005515 : protein binding and also this GO :0016301 : kinase activity and also this GO :0016534 : cyclin-dependent protein kinase 5 activator activity and also this GO :0019901 : protein kinase binding and also this GO :0043539 : protein serine/threonine kinase activator activity and also this GO :0045296 : cadherin binding and also this GO :0046875 : ephrin receptor binding, this GO :0004693 : cyclin-dependent protein serine/threonine kinase activity, this GO :0005509 : calcium ion binding, this GO :0005515 : protein binding, this GO :0016301 : kinase activity, this GO :0016534 : cyclin-dependent protein kinase 5 activator activity, this GO :0019901 : protein kinase binding, this GO :0043539 : protein serine/threonine kinase activator activity, this GO :0045296 : cadherin binding, this GO :0046875 : ephrin receptor binding, cyclin-dependent kinase 5
Identity: 1775
Gene: CDK5R1 | More about : CDK5R1
Long gene name: cyclin dependent kinase 5 regulatory subunit 1
Synonyms gene name: cyclin-dependent kinase 5, regulatory subunit 1 (p35)
Synonyms: p35nck5a Nck5a p35
Locus: 17q11, 2
Discovery year: 1999-03-08
GenBank acession: X80343
Entrez gene record: 8851
Pubmed identfication: 8090221
RefSeq identity: NM_003885
Havana BLAST/BLAT: OTTHUMG00000132814

Related Products :

A03C0211 anti-CDK5R1 Antibody 200ug (50ug, 100ug available) 465 € Bluegen antibodies human
C11065-1 anti-CDK5R1 Antibody 50 Вµg 347 € acr human
C11065-2 anti-CDK5R1 Antibody 0,1 mg 500 € acr human
CPA2333-100ul anti-CDK5R1 Antibody 0,1 ml 442 € acr human
CPA2333-200ul anti-CDK5R1 Antibody 0,2 ml 688 € acr human
CPA2333-30ul anti-CDK5R1 Antibody 30 Вµl 326 € acr human
GENTAUR-58bdf12dd469b Anti- CDK5R1 Antibody 0.12 ml 348 € MBS Polyclonals human
GENTAUR-58bdf12e2aea8 Anti- CDK5R1 Antibody 0.06 ml 265 € MBS Polyclonals human
abx149095 Anti-CDK5R1 Antibody inquire 50 € abbex human
AP06734PU-N anti-CDK5R1 p35 Antibody 0,1 mg 558 € acr human
GWB-ABACCE CDK5R1 antibody 1 vial 532 € genways human
GWB-ML011B Cdk5r1 antibody 1 vial 521 € genways human
R30162 CDK5R1 Antibody 0.1mg 389 € NJS poly human
GWB-ASD673 Human CDK5R1 Antibody bulk Ask price € genways bulk human
MBS854722 p35/CDK5R1 Antibody 100ug 370 € MBS Polyclonals_1 human
abx900969 Anti-CDK5R1 siRNA inquire 50 € abbex human
abx911281 Anti-CDK5R1 siRNA 30 nmol 717 € abbex human
abx911282 Anti-CDK5R1 siRNA 15 nmol 528 € abbex human
GENTAUR-58bd801fa5109 Bovine Cyclin-dependent kinase 5 activator 1 (CDK5R1) 100ug 1884 € MBS Recombinant Proteins bovine
GENTAUR-58bd80200e29e Bovine Cyclin-dependent kinase 5 activator 1 (CDK5R1) 1000ug 1884 € MBS Recombinant Proteins bovine
GENTAUR-58bd8020730c6 Bovine Cyclin-dependent kinase 5 activator 1 (CDK5R1) 100ug 2398 € MBS Recombinant Proteins bovine
GENTAUR-58bd8020d889d Bovine Cyclin-dependent kinase 5 activator 1 (CDK5R1) 1000ug 2398 € MBS Recombinant Proteins bovine
LV114392 CDK5R1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV) 1.0 µg DNA 322 € ABM lentivectors human
LV114393 CDK5R1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-C-term-HA) 1.0 µg DNA 322 € ABM lentivectors human
LV114394 CDK5R1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro) 1.0 µg DNA 322 € ABM lentivectors human
LV114395 CDK5R1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro) 1.0 µg DNA 322 € ABM lentivectors human
LV114397 CDK5R1 Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a) 1.0 µg DNA 322 € ABM lentivectors human
LV114396 CDK5R1 Lentiviral Vector (Human) (UbC) (pLenti-GIII-UbC) 1.0 µg DNA 322 € ABM lentivectors human
GWB-B319BC CDK5R1 Over-expression Lysate reagent 1 vial 463 € genways human
GWB-4E3CF6 antibody to or anti- CXC Chemokine Receptor 4 (CXCR4) Rabbit antibody to or anti-Human Polyclonal antibody antibody 1 x 1 vial 602 € genways human