| Category: |
Antibody |
| Concentration: |
2ml sterile DI water, 5mg/ml if reconstituted with 0 |
| Form: |
Antigen affinity purified |
| Conjugation: |
Unconjugated |
| Clone: |
Polyclonal antibody |
| Recognised antigen: |
ATP2A3 |
| Host animal: |
Rabbit (Oryctolagus cuniculus) |
| Clonality: |
Polyclonal (rabbit origin) |
| Species reactivity: |
Due to limited knowledge and inability to test the antibody against all known species, Mouse (Mus musculus), Rat , we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens) |
| Tested applications: |
IHC-P, WB |
| Recommended dilutions: |
5-1ug/ml, 5-1ug/ml, IHC (Paraffin): 0, Western blot: 0 |
| Notes: |
Titration of the ATP2A3 antibody may be required due to differences in protocols and secondary/substrate sensitivity, The stated application concentrations are suggested starting amounts |
| Intented use: |
This ATP2A3 antibodyis to be used only for research purposes and not for diagnostics |
| Gene ID #: |
489 |
| Purity: |
Antigen affinity |
| Description: |
ATP2A3 expression was originally described as non-muscular, It is mapped to 17p13, This enzyme catalyzes the hydrolysis of ATP coupled with the translocation of calcium from the cytosol to the sarcoplasmic reticulum lumen, This gene encodes one of the SERCA Ca2+-ATPases, What&rsquo, also known as SERCA3, and is involved in calcium sequestration associated with muscular excitation and contraction, but was recently observed in cardiomyocyte, is anenzyme that in humans is encoded by the ATP2A3 gene, the expression of ATP2A3 was significantly reduced or lost in colon carcinomas compared with normal colonic epithelial cells, which are intracellular pumps located in the sarcoplasmic or endoplasmic reticula of cells, 2, Sarcoplasmic/endoplasmic reticulum calcium ATPase 3, s more |
| Immunogen: |
An amino acid sequence from the N-terminus of human ATP2A3 (MEAAHLLPAADVLRHFSVTAEGGLSPAQVT) was used as the immunogen for this ATP2A3 antibody |
| Storage: |
Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, For long-term, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the ATP2A3 antibody can be stored for up to one month at 4oC, After reconstitution |
| Properties: |
C, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24° |
| Gene target: |
ATP2A3 |
| Short name: |
ATP2A3 Antibody |
| Technique: |
antibodies against human proteins, antibodies for, Antibody |
| Alternative name: |
ATP2A3 (Antibody to) |
| Alternative technique: |
antibodies |
| Identity: |
813 |
| Gene: |
ATP2A3 |
More about : ATP2A3 |
| Long gene name: |
ATPase sarcoplasmic/endoplasmic reticulum Ca2+ transporting 3 |
| Synonyms gene name: |
ATPase, Ca++ transporting, ubiquitous |
| Synonyms: |
SERCA3 |
| Synonyms name: |
sarcoplasmic/endoplasmic reticulum calcium ATPase 3 calcium pump 3 |
| Locus: |
17p13, 2 |
| Discovery year: |
1992-07-20 |
| Entrez gene record: |
489 |
| Pubmed identfication: |
8809064 |
| RefSeq identity: |
NM_174953 |
| Classification: |
ATPases Ca2+ transporting |
| Havana BLAST/BLAT: |
OTTHUMG00000177674 |