ATP2A3 Antibody

Contact us
Catalog number: R30157
Price: 729 €
Supplier: genways
Product name: ATP2A3 Antibody
Quantity: 1 tube
Other quantities: 1 vial 521€
Related search:

More details :

Category: Antibody
Concentration: 2ml sterile DI water, 5mg/ml if reconstituted with 0
Form: Antigen affinity purified
Conjugation: Unconjugated
Clone: Polyclonal antibody
Recognised antigen: ATP2A3
Host animal: Rabbit (Oryctolagus cuniculus)
Clonality: Polyclonal (rabbit origin)
Species reactivity: Due to limited knowledge and inability to test the antibody against all known species, Mouse (Mus musculus), Rat , we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens)
Tested applications: IHC-P, WB
Recommended dilutions: 5-1ug/ml, 5-1ug/ml, IHC (Paraffin): 0, Western blot: 0
Notes: Titration of the ATP2A3 antibody may be required due to differences in protocols and secondary/substrate sensitivity, The stated application concentrations are suggested starting amounts
Intented use: This ATP2A3 antibodyis to be used only for research purposes and not for diagnostics
Gene ID #: 489
Purity: Antigen affinity
Description: ATP2A3 expression was originally described as non-muscular, It is mapped to 17p13, This enzyme catalyzes the hydrolysis of ATP coupled with the translocation of calcium from the cytosol to the sarcoplasmic reticulum lumen, This gene encodes one of the SERCA Ca2+-ATPases, What&rsquo, also known as SERCA3, and is involved in calcium sequestration associated with muscular excitation and contraction, but was recently observed in cardiomyocyte, is anenzyme that in humans is encoded by the ATP2A3 gene, the expression of ATP2A3 was significantly reduced or lost in colon carcinomas compared with normal colonic epithelial cells, which are intracellular pumps located in the sarcoplasmic or endoplasmic reticula of cells, 2, Sarcoplasmic/endoplasmic reticulum calcium ATPase 3, s more
Immunogen: An amino acid sequence from the N-terminus of human ATP2A3 (MEAAHLLPAADVLRHFSVTAEGGLSPAQVT) was used as the immunogen for this ATP2A3 antibody
Storage: Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, For long-term, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the ATP2A3 antibody can be stored for up to one month at 4oC, After reconstitution
Properties: C, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24°
Gene target: ATP2A3
Short name: ATP2A3 Antibody
Technique: antibodies against human proteins, antibodies for, Antibody
Alternative name: ATP2A3 (Antibody to)
Alternative technique: antibodies
Identity: 813
Gene: ATP2A3 | More about : ATP2A3
Long gene name: ATPase sarcoplasmic/endoplasmic reticulum Ca2+ transporting 3
Synonyms gene name: ATPase, Ca++ transporting, ubiquitous
Synonyms: SERCA3
Synonyms name: sarcoplasmic/endoplasmic reticulum calcium ATPase 3 calcium pump 3
Locus: 17p13, 2
Discovery year: 1992-07-20
Entrez gene record: 489
Pubmed identfication: 8809064
RefSeq identity: NM_174953
Classification: ATPases Ca2+ transporting
Havana BLAST/BLAT: OTTHUMG00000177674

Related Products :

GENTAUR-58bdf695b7590 Anti- ATP2A3 Antibody 0.12 ml 348 € MBS Polyclonals human
GENTAUR-58bdf6960e95b Anti- ATP2A3 Antibody 0.06 ml 265 € MBS Polyclonals human
GENTAUR-58bdfa67939c2 Anti- ATP2A3 Antibody 0.12 ml 348 € MBS Polyclonals human
GENTAUR-58bdfa67e7f1d Anti- ATP2A3 Antibody 0.06 ml 265 € MBS Polyclonals human
GENTAUR-58be0c92f21be Anti- ATP2A3 Antibody 0.12 ml 348 € MBS Polyclonals human
GENTAUR-58be0c93722a7 Anti- ATP2A3 Antibody 0.06 ml 265 € MBS Polyclonals human
GENTAUR-58be3d257d3d1 Anti- ATP2A3 Antibody 100ug 393 € MBS Polyclonals human
AM31724PU-N anti-ATP2A3 / SERCA3 Antibody 50 Вµg 819 € acr human
GWB-MQ494H ATP2A3 antibody 1 vial 521 € genways human
R30157 ATP2A3 Antibody 0.1mg 389 € NJS poly human
YSRTMCA2952Z ATP2A3, Mouse Monoclonal antibody-; Clone: 2H3, IF,WB, Azide Free 0.1 mg Ask price € accurate-monoclonals mouse
APO-000489-M01 ATP2A3 Mouse Monoclonal Antibody (M01), clone 2H3 0.1mg 495 € Zyagen mouse
GENTAUR-58bde7be4100f Mouse Monoclonal [clone 2H3] (IgG2a,k) to Human ATP2A3 / SERCA3 Antibody 50ug 663 € MBS mono human
abx900519 Anti-ATP2A3 siRNA 15 nmol 528 € abbex human
abx908543 Anti-ATP2A3 siRNA 30 nmol 717 € abbex human
abx908544 Anti-ATP2A3 siRNA 30 nmol 717 € abbex human
LV794691 ATP2A3 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV) 1.0 µg DNA 1125 € ABM lentivectors human
LV794692 ATP2A3 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-C-term-HA) 1.0 µg DNA 1125 € ABM lentivectors human
LV794693 ATP2A3 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro) 1.0 µg DNA 1125 € ABM lentivectors human
LV794696 ATP2A3 Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a) 1.0 µg DNA 1125 € ABM lentivectors human
LV794695 ATP2A3 Lentiviral Vector (Human) (UbC) (pLenti-GIII-UbC) 1.0 µg DNA 1125 € ABM lentivectors human
GENTAUR-58bc63c78aa1a Pig Sarcoplasmic/endoplasmic reticulum calcium ATPase 3 (ATP2A3) 1000ug 1404 € MBS Recombinant Proteins pig
GENTAUR-58bc63c7da6f3 Pig Sarcoplasmic/endoplasmic reticulum calcium ATPase 3 (ATP2A3) 1000ug 1912 € MBS Recombinant Proteins pig
GWB-4E3CF6 antibody to or anti- CXC Chemokine Receptor 4 (CXCR4) Rabbit antibody to or anti-Human Polyclonal antibody antibody 1 x 1 vial 602 € genways human
GWB-BFD0EE antibody to or anti- Affinity Purified Chicken antibody to or anti-Pig CRP antibody 1 vial 414 € genways pig
GWB-75D1D0 antibody to or anti-ALPHA-1-antibody to or anti-TRYPSIN antibody 1 tube 667 € genways human
GWB-B22D54 antibody to or anti-ALPHA-1-antibody to or anti-TRYPSIN (Human Plasma) (Goat) antibody 1 vial 667 € genways human
GWB-B43069 antibody to or anti-Apaf1 (Mouse) Monoclonal antibody , antibody 1 vial 573 € genways mouse
GWB-A68C2D antibody to or anti- Brain-specificity angiogenesis inhibitor 2 antibody to or anti-Human antibody 1 vial 602 € genways human
GWB-6B2DC9 antibody to or anti- Control Immune Serum goat antibody to or anti- peptide sequence Carrier antibody 1 tube 729 € genways human