| Category: |
Antibody |
| Concentration: |
2ml sterile DI water, 5mg/ml if reconstituted with 0 |
| Form: |
Antigen affinity purified |
| Conjugation: |
Unconjugated |
| Clone: |
Polyclonal antibody |
| Recognised antigen: |
ATP2A1 |
| Host animal: |
Rabbit (Oryctolagus cuniculus) |
| Clonality: |
Polyclonal (rabbit origin) |
| Species reactivity: |
Due to limited knowledge and inability to test the antibody against all known species, Mouse (Mus musculus), Rat , we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens) |
| Tested applications: |
IHC-P, WB |
| Recommended dilutions: |
5-1ug/ml, 5-1ug/ml, IHC (Paraffin): 0, Western blot: 0 |
| Notes: |
Titration of the ATP2A1 antibody may be required due to differences in protocols and secondary/substrate sensitivity, The stated application concentrations are suggested starting amounts |
| Intented use: |
This ATP2A1 antibodyis to be used only for research purposes and not for diagnostics |
| Gene ID #: |
487 |
| Purity: |
Antigen affinity |
| Description: |
It has been determined that the human SERCA1 gene is 26 kb long and contains 23 exons, Mutations in this gene cause some autosomal recessive forms of Brody disease, The SERCA1 gene is mapped to 16p11, This enzyme catalyzes the hydrolysis of ATP coupled with the translocation of calcium from the cytosol to the sarcoplasmic reticulum lumen, This gene encodes one of the SERCA Ca(2+)-ATPases, also called ATP2A1, and is involved in muscular excitation and contraction, characterized by increasing impairment of muscular relaxation during exercise, is an enzyme that in humans is encoded by the ATP2A1 gene, of which can be alternatively spliced, which are intracellular pumps located in the sarcoplasmic or endoplasmic reticula of muscle cells, 2, SERCA1 |
| Immunogen: |
An amino acid sequence from the N-terminus of human ATP2A1 (MEAAHAKTTEECLAYFGVSETTGLTPDQVKRN) was used as the immunogen for this ATP2A1 antibody |
| Storage: |
Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, For long-term, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the ATP2A1 antibody can be stored for up to one month at 4oC, After reconstitution |
| Properties: |
C, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24° |
| Gene target: |
ATP2A1 |
| Short name: |
ATP2A1 Antibody |
| Technique: |
antibodies against human proteins, antibodies for, Antibody |
| Alternative name: |
Ca+and transporting, cardiac muscle, fast twitch 1 (Antibody to), ATPase |
| Alternative technique: |
antibodies |
| Alternative to gene target: |
ATP2A and SERCA1, ATP2A1 and IDBG-23611 and ENSG00000196296 and 487, Atp2a1 and IDBG-209499 and ENSMUSG00000030730 and 11937, BT, Ca++ transporting, Plasma membranes, cardiac muscle, fast twitch 1, metal ion binding, this GO :0000166 and nucleotide binding and molecular function this GO :0005388 and calcium-transporting ATPase activity and molecular function this GO :0005509 and calcium ion binding and molecular function this GO :0005515 and protein binding and molecular function this GO :0005524 and ATP binding and molecular function this GO :0005789 and endoplasmic reticulum membrane and cellular component this GO :0005793 and endoplasmic reticulum- this GO lgi intermediate compartment and cellular component this GO :0006200 and ATP catabolic process and biological process this GO :0006812 and cation transport and biological process this GO :0006816 and calcium ion transport and biological process this GO :0006942 and regulation of striated muscle contraction and biological process this GO :0007596 and blood coagulation and biological process this GO :0008152 and metabolic process and biological process this GO :0008637 and apoptotic mitochondrial changes and biological process this GO :0016020 and membrane and cellular component this GO :0016021 and integral component of membrane and cellular component this GO :0016529 and sarcoplasmic reticulum and cellular component this GO :0019829 and cation-transporting ATPase activity and molecular function this GO :0031095 and platelet dense tubular network membrane and cellular component this GO :0031448 and positive regulation of fast-twitch skeletal muscle fiber contraction and biological process this GO :0031673 and H zone and cellular component this GO :0031674 and I band and cellular component this GO :0032470 and positive regulation of endoplasmic reticulum calcium ion concentration and biological process this GO :0032471 and negative regulation of endoplasmic reticulum calcium ion concentration and biological process this GO :0033017 and sarcoplasmic reticulum membrane and cellular component this GO :0034220 and ion transmembrane transport and biological process this GO :0034704 and calcium channel complex and cellular component this GO :0034976 and response to endoplasmic reticulum stress and biological process this GO :0042803 and protein homodimerization activity and molecular function this GO :0045988 and negative regulation of striated muscle contraction and biological process this GO :0046872 and metal ion binding and molecular function this GO :0048471 and perinuclear region of cytoplasm and cellular component this GO :0051561 and positive regulation of mitochondrial calcium ion concentration and biological process this GO :0051659 and maintenance of mitochondrion location and biological process this GO :0055085 and transmembrane transport and biological process this GO :0070059 and intrinsic apoptotic signaling pathway in response to endoplasmic reticulum stress and biological process this GO :0070509 and calcium ion import and biological process this GO :0070588 and calcium ion transmembrane transport and biological process this GO :0090076 and relaxation of skeletal muscle and biological process, this GO :0000166 : nucleotide binding, this GO :0000166 : nucleotide binding and also this GO :0005388 : calcium-transporting ATPase activity and also this GO :0005509 : calcium ion binding and also this GO :0005515 : protein binding and also this GO :0005524 : ATP binding and also this GO :0019829 : cation-transporting ATPase activity and also this GO :0042803 : protein homodimerization activity and also this GO :0046872 : metal ion binding, this GO :0005388 : calcium-transporting ATPase activity, this GO :0005509 : calcium ion binding, this GO :0005515 : protein binding, this GO :0005524 : ATP binding, this GO :0019829 : cation-transporting ATPase activity, this GO :0042803 : protein homodimerization activity, this GO :0046872 : metal ion binding, 62768 and IDBG-638938 and ENSBTAG00000006541 and 518117, ATPase |
| Identity: |
811 |
| Gene: |
ATP2A1 |
More about : ATP2A1 |
| Long gene name: |
ATPase sarcoplasmic/endoplasmic reticulum Ca2+ transporting 1 |
| Synonyms gene: |
ATP2A |
| Synonyms gene name: |
ATPase, Ca++ transporting, cardiac muscle, fast twitch 1 |
| Synonyms: |
SERCA1 |
| Synonyms name: |
sarcoplasmic/endoplasmic reticulum calcium ATPase 1 calcium pump 1 |
| Locus: |
16p11, 2 |
| Discovery year: |
1990-09-10 |
| Entrez gene record: |
487 |
| RefSeq identity: |
NM_004320 |
| Classification: |
ATPases Ca2+ transporting |
| Havana BLAST/BLAT: |
OTTHUMG00000131760 |