Recombinant Human S100A7

Contact us
Catalog number: CR28
Price: 485 €
Supplier: acr
Product name: Recombinant Human S100A7
Quantity: 0,1 mg
Other quantities: 1 mg 1877€ 50 µg 369€ 500 µg 1328€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Recombinant Human S100A7 is produced by our E, coli expression system and the target gene encoding Met1-Gln101 is expressed
Molecular Weight: 11, 5 kD
UniProt number: P31151
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: pH7, 2 um filtered solution of phosphate buffered saline, 4, Lyophilized from a 0
Storage recommendations: -20°, -20°, Aliquots of reconstituted samples are stable at <, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 4 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: MSNTQAERSIIGMIDMFHKYTRRDDKIEKPSLLTMMKENFPNFLSACDKKGTNYLADVFEKKDKNEDKKIDFSEFLSLLGDIATDYHKQSHGAAPCSGGSQ
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: S100A7
Short name: Recombinant S100A7
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans, Human
Alternative name: sapiens S100 calcium binding protein A7, recombinant H
Alternative technique: rec
Alternative to gene target: PSOR1 and S100A7c, RAGE receptor binding, S100A7 and IDBG-102676 and ENSG00000143556 and 6278, nuclei, this GO :0000302 and response to reactive oxygen species and biological process this GO :0001525 and angiogenesis and biological process this GO :0005509 and calcium ion binding and molecular function this GO :0005515 and protein binding and molecular function this GO :0005576 and extracellular region and cellular component this GO :0005634 and nucleus and cellular component this GO :0005737 and cytoplasm and cellular component this GO :0005783 and endoplasmic reticulum and cellular component this GO :0005829 and cytosol and cellular component this GO :0005925 and focal adhesion and cellular component this GO :0008270 and zinc ion binding and molecular function this GO :0008544 and epidermis development and biological process this GO :0010820 and positive regulation of T cell chemotaxis and biological process this GO :0030216 and keratinocyte differentiation and biological process this GO :0032496 and response to lipopolysaccharide and biological process this GO :0045087 and innate immune response and biological process this GO :0050786 and RAGE receptor binding and molecular function this GO :0050829 and defense response to Gram-negative bacterium and biological process this GO :0051238 and sequestering of metal ion and biological process this GO :0070062 and extracellular vesicular exosome and cellular component this GO :0070374 and positive regulation of ERK1 and ERK2 cascade and biological process this GO :0071624 and positive regulation of granulocyte chemotaxis and biological process this GO :0090026 and positive regulation of monocyte chemotaxis and biological process, this GO :0005509 : calcium ion binding, this GO :0005509 : calcium ion binding and also this GO :0005515 : protein binding and also this GO :0008270 : zinc ion binding and also this GO :0050786 : RAGE receptor binding, this GO :0005515 : protein binding, this GO :0008270 : zinc ion binding, this GO :0050786 : RAGE receptor binding, S100 calcium binding protein A7
Identity: 10497
Gene: S100A7 | More about : S100A7
Long gene name: S100 calcium binding protein A7
Synonyms gene: PSOR1
Synonyms gene name: S100 calcium-binding protein A7 (psoriasin 1) S100 calcium binding protein A7 (psoriasin 1)
Synonyms: S100A7c
Locus: 1q21, 3
Discovery year: 1992-10-08
GenBank acession: BC034687
Entrez gene record: 6278
Pubmed identfication: 1940442
RefSeq identity: NM_002963
Classification: S100 calcium binding proteins EF-hand domain containing
Havana BLAST/BLAT: OTTHUMG00000013123

Related Products :

CR28 Recombinant Human S100A7 500 µg 1328 € novo human
RP-1354H Recombinant Human S100A7 / PSOR1 Protein 20μg 572 € adv human
abx166032 Anti-S100A7 (Recombinant) 10 μg 427 € abbex human
GWB-P1047G S100A7, 1-101aa, Recombinant Protein bulk Ask price € genways bulk human
abx153004 Anti-Human S100A7 ELISA Kit inquire 50 € abbex human
abx574346 Anti-Human S100A7 ELISA Kit inquire 50 € abbex human
MBS247831 Goat Polyclonal to Human S100A7 / Psoriasin Antibody 50ug 597 € MBS Polyclonals_1 human
DL-S100A7-Hu Human S100 Calcium Binding Protein A7 S100A7 ELISA Kit 96T 904 € DL elisas human
GENTAUR-58bde5c8defd7 Mouse Monoclonal [clone 47C1068] (IgG1,k) to Human S100A7 / Psoriasin Antibody 50ug 597 € MBS mono human
GENTAUR-58bde5c882bfd Mouse Monoclonal [clone 47C1068] to Human S100A7 / Psoriasin Antibody 50ug 597 € MBS mono human
GWB-3DC371 S100 Calcium-binding protein A7 (S100A7) Mouse antibody to or anti-Human Monoclonal (47C1068) antibody 1 x 1 vial 602 € genways human
GWB-E43D2C S100 Calcium-binding protein A7 (S100A7) Mouse antibody to or anti-Human Monoclonal antibody 1 vial 602 € genways human
GWB-BSP631 S100A7 Human Protein bulk Ask price € genways bulk human
LV294825 S100A7 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV) 1.0 µg DNA 322 € ABM lentivectors human
abx154631 Anti-Mouse S100A7 ELISA Kit 96 tests 949 € abbex mouse
abx254397 Anti-Mouse S100A7 ELISA Kit inquire 50 € abbex mouse
abx571956 Anti-Mouse S100A7 ELISA Kit 96 tests 804 € abbex mouse
GENTAUR-58bdc57b6b925 Anti- S100 Calcium Binding Protein A7 (S100A7) Antibody 100ug 503 € MBS Polyclonals human
GENTAUR-58bdc57c0999b Anti- S100 Calcium Binding Protein A7 (S100A7) Antibody 50ug 382 € MBS Polyclonals human
GENTAUR-58bdcabb06f97 Anti- S100 Calcium Binding Protein A7 (S100A7) Antibody 50ug 376 € MBS Polyclonals human
GENTAUR-58bdcabb6f7ed Anti- S100 Calcium Binding Protein A7 (S100A7) Antibody 100ug 492 € MBS Polyclonals human
GENTAUR-58bdcf6f2217e Anti- S100 Calcium Binding Protein A7 (S100A7) Antibody 100ug 531 € MBS Polyclonals human
GENTAUR-58bdd34846db3 Anti- S100 Calcium Binding Protein A7 (S100A7) Antibody 100ug 542 € MBS Polyclonals human
GENTAUR-58bdd65030858 Anti- S100 Calcium Binding Protein A7 (S100A7) Antibody 100ug 564 € MBS Polyclonals human
GENTAUR-58bdda483ced5 Anti- S100 Calcium Binding Protein A7 (S100A7) Antibody 100ug 575 € MBS Polyclonals human
GENTAUR-58be435dbb073 Anti- S100A7 Antibody 100ug 393 € MBS Polyclonals human
abx218417 Anti-S100A7 Antibody 200 μg 369 € abbex human
GENTAUR-58be64611ce02 Anti-S100A7 (Polyclonal), ALEXA Fluor 594 100 microliters 489 € Bioss Polyclonal Antibodies human
AR09931PU-L anti-S100A7 / Psoriasin (1-101, His-tag) Antibody 0,5 mg 1138 € acr human
AR09931PU-N anti-S100A7 / Psoriasin (1-101, His-tag) Antibody 0,1 mg 485 € acr human